• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • PPI
    • iRefIndex
    • PINA
    • HINT
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Tca-121491
Ensembl Protein ID EOY01476
UniProt Accession A0A061E937; A0A061E937_THECC
Genbank Protein ID EOY01476.1
Protein Name NEDD8-activating enzyme E1 regulatory subunit
Genbank Nucleotide ID CM001880
Gene Name TCM_011349
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
TCM_011349 EOY01476 EOY01476
Status Unreviewed
Classification
Family E-Value Score Start End
E1 4.20e-115 386.2 8 514
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E1

   S: 1    YDRQirlwGeeaqeklksakvllvGagglGcEllKnLvlaGvgsitvvDmdtvevsnlnrqFLfraedvgksKAevaaealkelnpdvnveaheesitele 101
    YDRQ+r+wGe++q++l++a+++l+++g++G+E+lKnLvl+Gvgsit+vD+++ve+ +l+++F++++++ g+sKA++++ +l+eln+ v++++ ee +++l
   Q: 8 YDRQLRIWGEQGQAALEKASICLLNCGPTGSETLKNLVLGGVGSITIVDGSKVELGDLGNNFMVDESSLGQSKAKCVCSFLQELNDAVKAKFIEEYPEALI 108
    ***************************************************************************************************** PP
   S: 102 eeiv.FfkkfdvVvlaldnrearrkvnrlclnarvpliesgtlGllGqvrviikgltecyscsd...dppqktiPfctlketpn.........aaehtiew 189
    ++++ Ff++f++Vv+++ +e++ k++r+c++a+v li ++++Gl G vr+++k++ +++s++d d++++++P+++l+ + + +a+++i++
   Q: 109 DTNPsFFSQFTLVVATQLVEESMVKLDRICREANVMLIFARSYGLTGLVRISVKEHAVIESKPDhflDDLRLNNPWPELRGFAEaidlnvqdpVAHKHIPY 209
    **********************************************************************************98899999999******** PP
   S: 190 avlfnklleeeageeevlekldseekeegkdkvkselksedeenfeeaieiavkafakttins.ikqllksfecdivtkskspfwv............... 274
    +v++ k+++e+ +++ ++ ++++eek+e+k++ k++++++de+n++eai +++k fa++ i+s +q++ + +c++v +++s+fwv
   Q: 210 VVILVKMADEWIKSHGGSLPSTREEKREFKELLKARMVAMDEDNYKEAIDASFKVFAPRGISSdLQQIIID-SCAEVASNSSDFWVmvaalkefianeggg 309
    ***************************************************************99999888.9**************************** PP
   S: 275 ............................................................sfcsnaealq...........vpekvekdeevvkasap... 301
    sfc+na++l+ +++ + +++++++++
   Q: 310 eaplegsipdmtsstehyvnlqkiyqakseadflviekrvrnilkkigrdpnsipkatikSFCKNARKLKvcryrliedeyNNPSLPELQKYLTDEDYsia 410
    **********************************************************************77777777777669999999999999999** PP
   S: 302 ..lylllralerfekkkgrkpgelsfekdddsavdlvtaaanlraeslgiep.kldddlikeiagniipaiattnavvgGlaaqEviKvvsgkfeplknff 399
    +y+llra++r +++ ++ pg+++ +d+d + +l+t+a l ++g+++ l++dli e++++++++++ ++a++gG+a+qEviK+++++f+p+ ++
   Q: 411 vgFYILLRAVDRYAANFNSFPGQFDGGMDED-ISRLKTTAVGLL-NDFGCNGlTLTEDLINEMCRFGAAELHAVAAFIGGIASQEVIKLITKQFVPMSGTY 509
    *******************************.******999998.******************************************************** PP
   S: 400 lfdae 404
    +f+++
   Q: 510 VFNGI 514
    99986 PP
   

Organism Theobroma cacao
Functional Description
(View)

Functional Description



     Regulatory subunit of the dimeric E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1.
Regulatory subunit of the dimeric E1 enzyme. E1 activates RUB1/NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a RUB1-ECR1 thioester and free AMP. E1 finally transfers RUB1 to the catalytic cysteine of RCE1.
Protein Sequence
(Fasta)
MAEPKTKYDR QLRIWGEQGQ AALEKASICL LNCGPTGSET LKNLVLGGVG SITIVDGSKV 60
ELGDLGNNFM VDESSLGQSK AKCVCSFLQE LNDAVKAKFI EEYPEALIDT NPSFFSQFTL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Tca-121491|E1,E1_ThiF|Theobroma cacao
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GCCTTGTAAA ACACACCGTT GCACTAATTG ACAGCCTCGG CGTTGTCCTC AAAACGCACA 60
CGGACAGTGC GTGGACTGTA ACTGTGCGTA GTAAGCAAGC GAAGAAGCAA TTAAGTTAAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Tca-121491|E1,E1_ThiF|Theobroma cacao
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR030667--APP-BP1
IPR016040--NAD(P)-bd_dom
IPR000594--ThiF_NAD_FAD-bd

Pfam

PF00899--ThiF

Gene Ontology

GO:0019781--F:NEDD8 activating enzyme activity
GO:0045116--P:protein neddylation

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000764 Aegilops tauschii 68.06 0.00e+00 759.00
IUUC-Aml-002333 Ailuropoda melanoleuca 40.82 2.00e-124 438.00
IUUC-Atr-002644 Amborella trichopoda 75.91 0.00e+00 811.00
IUUC-Apl-003446 Anas platyrhynchos 39.66 2.00e-114 405.00
IUUC-Aca-004450 Anolis carolinensis 38.97 2.00e-120 425.00
IUUC-Aly-005466 Arabidopsis lyrata 79.77 0.00e+00 897.00
IUUC-Ath-006692 Arabidopsis thaliana 80.53 0.00e+00 907.00
IUUC-Ago-007900 Ashbya gossypii 27.32 1.00e-38 153.00
IUUC-Acl-008333 Aspergillus clavatus 32.54 6.00e-72 264.00
IUUC-Afl-008529 Aspergillus flavus 33.33 7.00e-79 287.00
IUUC-Afu-009071 Aspergillus fumigatus 32.97 3.00e-72 265.00
IUUC-Ani-009443 Aspergillus nidulans 31.08 5.00e-67 248.00
IUUC-Ang-009669 Aspergillus niger 31.72 1.00e-75 276.00
IUUC-Aor-009914 Aspergillus oryzae 32.97 2.00e-77 282.00
IUUC-Ate-010450 Aspergillus terreus 34.12 3.00e-78 285.00
IUUC-Ame-011183 Astyanax mexicanus 38.99 2.00e-120 425.00
IUUC-Bgr-012111 Blumeria graminis 33.40 4.00e-64 238.00
IUUC-Bta-012583 Bos taurus 40.60 7.00e-125 440.00
IUUC-Bci-013892 Botrytis cinerea 31.75 3.00e-60 225.00
IUUC-Bdi-014592 Brachypodium distachyon 68.33 0.00e+00 760.00
IUUC-Bol-016399 Brassica oleracea 81.07 0.00e+00 913.00
IUUC-Bra-018084 Brassica rapa 77.82 0.00e+00 850.00
IUUC-Cel-018456 Caenorhabditis elegans 31.04 3.00e-72 265.00
IUUC-Cja-020007 Callithrix jacchus 40.74 4.00e-124 437.00
IUUC-Cfa-020324 Canis familiaris 40.97 3.00e-126 444.00
IUUC-Cpo-022248 Cavia porcellus 35.55 9.00e-66 243.00
IUUC-Csa-023149 Chlorocebus sabaeus 38.02 3.00e-96 344.00
IUUC-Cho-024537 Choloepus hoffmanni 34.48 9.00e-85 306.00
IUUC-Cin-025763 Ciona intestinalis 40.98 2.00e-114 405.00
IUUC-Csv-026113 Ciona savignyi 40.55 5.00e-110 390.00
IUUC-Cgl-026428 Colletotrichum gloeosporioides 30.27 5.00e-58 218.00
IUUC-Cne-026884 Cryptococcus neoformans 33.08 4.00e-71 261.00
IUUC-Cme-027210 Cyanidioschyzon merolae 23.04 6.00e-13 68.60
IUUC-Dre-028140 Danio rerio 40.49 2.00e-125 441.00
IUUC-Dno-030033 Dasypus novemcinctus 39.74 2.00e-105 375.00
IUUC-Dor-030513 Dipodomys ordii 34.26 2.00e-36 145.00
IUUC-Dse-031536 Dothistroma septosporum 31.35 1.00e-67 250.00
IUUC-Dme-031683 Drosophila melanogaster 38.27 3.00e-101 361.00
IUUC-Ete-032420 Echinops telfairi 36.54 6.00e-108 383.00
IUUC-Eca-033992 Equus caballus 38.57 1.00e-95 342.00
IUUC-Eeu-034713 Erinaceus europaeus 32.52 1.00e-37 150.00
IUUC-Fca-036548 Felis catus 40.41 7.00e-125 439.00
IUUC-Fal-037600 Ficedula albicollis 40.15 7.00e-115 406.00
IUUC-Fox-038037 Fusarium oxysporum 30.63 5.00e-64 238.00
IUUC-Fso-038387 Fusarium solani 32.01 2.00e-66 245.00
IUUC-Gmo-038562 Gadus morhua 38.45 3.00e-117 414.00
IUUC-Ggr-040005 Gaeumannomyces graminis 33.15 2.00e-64 239.00
IUUC-Gga-041129 Gallus gallus 39.59 9.00e-117 413.00
IUUC-Gac-042558 Gasterosteus aculeatus 39.77 2.00e-120 424.00
IUUC-Gma-043610 Glycine max 87.38 0.00e+00 937.00
IUUC-Ggo-045611 Gorilla gorilla 40.83 9.00e-123 432.00
IUUC-Hsa-046563 Homo sapiens 41.06 5.00e-124 437.00
IUUC-Hvu-047790 Hordeum vulgare 65.30 2.00e-155 541.00
IUUC-Itr-048066 Ictidomys tridecemlineatus 40.97 9.00e-125 439.00
IUUC-Kpa-049309 Komagataella pastoris 35.37 8.00e-75 273.00
IUUC-Lch-050038 Latimeria chalumnae 39.47 2.00e-118 418.00
IUUC-Lpe-051535 Leersia perrieri 68.02 0.00e+00 684.00
IUUC-Loc-051917 Lepisosteus oculatus 36.98 2.00e-107 382.00
IUUC-Lma-053112 Leptosphaeria maculans 33.16 6.00e-77 280.00
IUUC-Laf-053690 Loxodonta africana 41.53 6.00e-126 443.00
IUUC-Mcc-055117 Macaca mulatta 39.74 9.00e-120 422.00
IUUC-Meu-056761 Macropus eugenii 32.72 1.00e-87 316.00
IUUC-Mor-057230 Magnaporthe oryzae 33.27 2.00e-66 246.00
IUUC-Mpo-057514 Magnaporthe poae 32.55 8.00e-63 233.00
IUUC-Mtr-058551 Medicago truncatula 80.15 0.00e+00 867.00
IUUC-Mla-059183 Melampsora laricipopulina 35.28 3.00e-88 318.00
IUUC-Mga-060144 Meleagris gallopavo 39.20 2.00e-113 401.00
IUUC-Mvi-060221 Microbotryum violaceum 32.06 9.00e-72 263.00
IUUC-Mmr-061325 Microcebus murinus 39.44 3.00e-120 424.00
IUUC-Mdo-062532 Monodelphis domestica 41.13 4.00e-124 437.00
IUUC-Mmu-063956 Mus musculus 40.41 7.00e-125 440.00
IUUC-Mac-064521 Musa acuminata 73.80 0.00e+00 822.00
IUUC-Mpu-066716 Mustela putorius furo 40.00 6.00e-115 407.00
IUUC-Mlu-067459 Myotis lucifugus 41.35 6.00e-126 443.00
IUUC-Nfi-068245 Neosartorya fischeri 33.03 2.00e-72 265.00
IUUC-Ncr-068910 Neurospora crassa 33.89 1.00e-69 256.00
IUUC-Nle-070034 Nomascus leucogenys 39.62 5.00e-118 417.00
IUUC-Opr-070552 Ochotona princeps 37.30 1.00e-95 343.00
IUUC-Ont-071426 Oreochromis niloticus 39.36 7.00e-123 433.00
IUUC-Oan-073389 Ornithorhynchus anatinus 37.89 8.00e-89 320.00
IUUC-Ocu-074911 Oryctolagus cuniculus 40.97 7.00e-126 443.00
IUUC-Oba-075437 Oryza barthii 70.44 0.00e+00 738.00
IUUC-Obr-076684 Oryza brachyantha 69.94 0.00e+00 696.00
IUUC-Ogl-077170 Oryza glaberrima 70.44 0.00e+00 738.00
IUUC-Ogu-078844 Oryza glumaepatula 69.56 0.00e+00 686.00
IUUC-Oin-079105 Oryza indica 70.25 0.00e+00 735.00
IUUC-Olo-080943 Oryza longistaminata 67.81 0.00e+00 665.00
IUUC-Oni-082891 Oryza nivara 68.14 0.00e+00 710.00
IUUC-Opu-083457 Oryza punctata 70.44 0.00e+00 738.00
IUUC-Oru-084960 Oryza rufipogon 67.74 0.00e+00 667.00
IUUC-Osa-085358 Oryza sativa 70.06 0.00e+00 731.00
IUUC-Ola-086420 Oryzias latipes 36.70 2.00e-77 281.00
IUUC-Olu-087625 Ostreococcus lucimarinus 31.16 9.00e-62 230.00
IUUC-Oga-088810 Otolemur garnettii 40.78 4.00e-125 441.00
IUUC-Oar-089196 Ovis aries 40.37 3.00e-123 434.00
IUUC-Ptr-090617 Pan troglodytes 41.06 4.00e-124 437.00
IUUC-Pan-092761 Papio anubis 40.78 3.00e-125 441.00
IUUC-Psi-093191 Pelodiscus sinensis 39.04 1.00e-118 419.00
IUUC-Pma-094380 Petromyzon marinus 40.08 6.00e-110 390.00
IUUC-Pno-095084 Phaeosphaeria nodorum 33.21 5.00e-66 245.00
IUUC-Ppa-095798 Physcomitrella patens 56.58 0.00e+00 646.00
IUUC-Pfo-096467 Poecilia formosa 39.51 2.00e-118 419.00
IUUC-Pab-098255 Pongo abelii 40.27 9.00e-101 359.00
IUUC-Pop-099722 Populus trichocarpa 86.62 0.00e+00 959.00
IUUC-Pca-100807 Procavia capensis 50.27 1.00e-51 196.00
IUUC-Ppe-101280 Prunus persica 88.15 0.00e+00 973.00
IUUC-Pva-102333 Pteropus vampyrus 39.44 2.00e-117 415.00
IUUC-Pgr-103401 Puccinia graminis 28.71 4.00e-72 264.00
IUUC-Ptt-103889 Puccinia triticina 27.37 4.00e-61 228.00
IUUC-Pte-104355 Pyrenophora teres 33.15 4.00e-74 271.00
IUUC-Pyt-104545 Pyrenophora triticirepentis 33.82 7.00e-75 273.00
IUUC-Rno-105810 Rattus norvegicus 40.49 7.00e-124 436.00
IUUC-Sce-106397 Saccharomyces cerevisiae 27.74 1.00e-29 123.00
IUUC-Sha-106770 Sarcophilus harrisii 45.76 6.00e-69 253.00
IUUC-Sja-107926 Schizosaccharomyces japonicus 32.00 1.00e-76 279.00
IUUC-Spo-108276 Schizosaccharomyces pombe 32.44 8.00e-84 303.00
IUUC-Ssl-108387 Sclerotinia sclerotiorum 32.11 7.00e-59 220.00
IUUC-Smo-109296 Selaginella moellendorffii 53.18 7.00e-165 572.00
IUUC-Sit-110157 Setaria italica 70.36 0.00e+00 802.00
IUUC-Sly-111105 Solanum lycopersicum 77.47 0.00e+00 884.00
IUUC-Stu-112469 Solanum tuberosum 78.58 0.00e+00 897.00
IUUC-Sar-113083 Sorex araneus 38.65 6.00e-43 167.00
IUUC-Sbi-113813 Sorghum bicolor 69.22 0.00e+00 794.00
IUUC-Sre-115058 Sporisorium reilianum 32.96 4.00e-63 234.00
IUUC-Tgu-116772 Taeniopygia guttata 40.75 3.00e-115 407.00
IUUC-Tru-118686 Takifugu rubripes 38.61 5.00e-122 430.00
IUUC-Tsy-119111 Tarsius syrichta 41.91 5.00e-59 221.00
IUUC-Tni-120231 Tetraodon nigroviridis 36.26 2.00e-105 375.00
IUUC-Tre-122103 Trichoderma reesei 33.08 3.00e-69 255.00
IUUC-Tvi-122672 Trichoderma virens 32.90 1.00e-66 246.00
IUUC-Tae-125316 Triticum aestivum 68.91 0.00e+00 766.00
IUUC-Tur-126487 Triticum urartu 67.31 0.00e+00 737.00
IUUC-Tme-127097 Tuber melanosporum 33.89 1.00e-77 283.00
IUUC-Ttr-128465 Tursiops truncatus 38.33 1.00e-111 396.00
IUUC-Uma-129645 Ustilago maydis 31.57 1.00e-69 256.00
IUUC-Vda-129989 Verticillium dahliae 28.91 7.00e-49 187.00
IUUC-Vpa-130529 Vicugna pacos 38.89 1.00e-114 405.00
IUUC-Vvi-131059 Vitis vinifera 88.91 0.00e+00 969.00
IUUC-Xtr-132002 Xenopus tropicalis 40.68 5.00e-125 440.00
IUUC-Xma-133930 Xiphophorus maculatus 39.43 1.00e-120 426.00
IUUC-Yli-134505 Yarrowia lipolytica 33.59 2.00e-82 298.00
IUUC-Zma-135619 Zea mays 68.83 0.00e+00 752.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved