• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • Mentha
    • InWeb_IM
  • Disease
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
UUCD2 ID IUUC-Sbi-114191
UUCD1 version UUC-SoB-00980
Ensembl Protein ID Sb06g016930.1
UniProt Accession C5Y8N2; C5Y8N2_SORBI
Genbank Protein ID EES10826.1
Protein Name Uncharacterized protein
Genbank Nucleotide ID CM000765
Gene Name SORBI_006G082600
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
Sb06g016930 Sb06g016930.1 Sb06g016930.1
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/SCF/F-box 7.10e-06 26.9 57 102
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/F-box

   S: 101  glldrlpeeilveilklldkeellraarvcrrwqelasqkalwktv 146
    + + lp+e+++ei++++++ +l+raa+vcr+w+ +a++++lw+++
   Q: 57 LIHHCLPDELMLEIFTRMSPYTLGRAACVCRKWKYTARNPTLWRAA 102
    456789****************************99999****987 PP
   

Organism Sorghum bicolor
Protein Sequence
(Fasta)
MASSDISVDI RPDINSFDHF LSMRYIATDR PWLKLYGIRV QPVPPFSSLS YKPDPALIHH 60
CLPDELMLEI FTRMSPYTLG RAACVCRKWK YTARNPTLWR AACLKTWQRS GLEANYMMVR 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Sbi-114191|E3,F-box|Sorghum bicolor
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CGAGCGTTGG TTCGTAGGTC CGGATTTTTT TCTTCCTGGG GCGTGATTCG TGGCTGAGAG 60
AGGATCAGAA GAGGGAACGG CTATTGACTA TTCAGTGCTC GCGAGCGAGC TTCCCACCGT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Sbi-114191|E3,F-box|Sorghum bicolor
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR001810--F-box_dom

PROSITE

PS50181--FBOX

Pfam

PF12937--F-box-like

SMART

SM00256--FBOX

Gene Ontology

GO:0005739--C:mitochondrion
GO:0005634--C:nucleus
GO:0090406--C:pollen tube
GO:0006417--P:regulation of translation
GO:0009409--P:response to cold
GO:0009408--P:response to heat

KEGG sbi:SORBI_06g016930
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000378 Aegilops tauschii 68.35 5.00e-85 306.00
IUUC-Aml-001660 Ailuropoda melanoleuca 36.02 2.00e-24 106.00
IUUC-Atr-003042 Amborella trichopoda 62.66 3.00e-118 417.00
IUUC-Apl-004118 Anas platyrhynchos 35.19 9.00e-22 97.10
IUUC-Aca-005282 Anolis carolinensis 36.02 3.00e-24 105.00
IUUC-Aly-005616 Arabidopsis lyrata 60.19 3.00e-121 427.00
IUUC-Ath-007590 Arabidopsis thaliana 60.19 3.00e-120 424.00
IUUC-Acl-008135 Aspergillus clavatus 20.79 4.00e-06 45.40
IUUC-Afl-008699 Aspergillus flavus 23.12 3.00e-08 52.40
IUUC-Afu-008824 Aspergillus fumigatus 24.87 8.00e-07 47.80
IUUC-Ani-009388 Aspergillus nidulans 26.83 3.00e-10 58.90
IUUC-Ang-009815 Aspergillus niger 24.86 2.00e-08 53.10
IUUC-Ate-010365 Aspergillus terreus 24.21 1.00e-06 47.40
IUUC-Ame-011406 Astyanax mexicanus 35.19 4.00e-23 101.00
IUUC-Bgr-012145 Blumeria graminis 24.71 3.00e-12 65.50
IUUC-Bta-012354 Bos taurus 35.19 2.00e-24 105.00
IUUC-Bci-013686 Botrytis cinerea 26.40 2.00e-12 66.20
IUUC-Bdi-014609 Brachypodium distachyon 85.63 1.00e-164 571.00
IUUC-Bol-016149 Brassica oleracea 57.72 2.00e-115 407.00
IUUC-Bra-017126 Brassica rapa 56.76 9.00e-115 405.00
IUUC-Cfa-020387 Canis familiaris 36.02 2.00e-24 106.00
IUUC-Cpo-021298 Cavia porcellus 36.65 2.00e-24 105.00
IUUC-Cre-022803 Chlamydomonas reinhardtii 31.71 1.00e-42 166.00
IUUC-Csa-024074 Chlorocebus sabaeus 36.02 8.00e-25 107.00
IUUC-Cho-024705 Choloepus hoffmanni 36.02 6.00e-25 107.00
IUUC-Cin-025508 Ciona intestinalis 34.59 8.00e-18 84.00
IUUC-Csv-026173 Ciona savignyi 33.09 6.00e-18 84.30
IUUC-Cgl-026681 Colletotrichum gloeosporioides 27.47 3.00e-13 69.30
IUUC-Cne-026854 Cryptococcus neoformans 26.32 4.00e-14 72.00
IUUC-Cme-027201 Cyanidioschyzon merolae 32.10 3.00e-17 81.60
IUUC-Dre-027811 Danio rerio 34.68 1.00e-23 103.00
IUUC-Dno-029907 Dasypus novemcinctus 36.02 7.00e-25 107.00
IUUC-Dor-030126 Dipodomys ordii 36.02 5.00e-25 107.00
IUUC-Dse-031460 Dothistroma septosporum 31.68 5.00e-10 58.20
IUUC-Dme-031882 Drosophila melanogaster 33.95 3.00e-19 89.00
IUUC-Ete-032852 Echinops telfairi 34.21 5.00e-08 51.60
IUUC-Eca-033835 Equus caballus 36.02 1.00e-24 107.00
IUUC-Eeu-034960 Erinaceus europaeus 35.40 2.00e-24 106.00
IUUC-Fca-035547 Felis catus 36.65 7.00e-25 107.00
IUUC-Fal-037181 Ficedula albicollis 34.78 7.00e-22 97.40
IUUC-Fox-038043 Fusarium oxysporum 23.44 4.00e-10 58.90
IUUC-Fso-038242 Fusarium solani 32.43 3.00e-08 52.40
IUUC-Gmo-039658 Gadus morhua 32.94 7.00e-22 97.40
IUUC-Ggr-040039 Gaeumannomyces graminis 39.39 1.00e-07 50.40
IUUC-Gga-040387 Gallus gallus 35.40 5.00e-23 101.00
IUUC-Gac-042247 Gasterosteus aculeatus 32.10 2.00e-19 89.40
IUUC-Gma-043457 Glycine max 62.42 3.00e-126 443.00
IUUC-Ggo-045216 Gorilla gorilla 35.80 3.00e-23 102.00
IUUC-Hsa-046445 Homo sapiens 36.02 7.00e-25 107.00
IUUC-Hvu-047506 Hordeum vulgare 85.63 3.00e-173 599.00
IUUC-Kpa-049180 Komagataella pastoris 24.50 6.00e-08 50.80
IUUC-Lch-049659 Latimeria chalumnae 34.57 6.00e-23 101.00
IUUC-Lpe-051160 Leersia perrieri 71.49 7.00e-94 335.00
IUUC-Loc-051734 Lepisosteus oculatus 35.80 3.00e-24 105.00
IUUC-Lma-053018 Leptosphaeria maculans 32.39 3.00e-06 45.80
IUUC-Laf-053937 Loxodonta africana 35.40 5.00e-24 104.00
IUUC-Mcc-055178 Macaca mulatta 36.02 8.00e-25 107.00
IUUC-Meu-056886 Macropus eugenii 33.93 3.00e-06 46.20
IUUC-Mor-056938 Magnaporthe oryzae 37.31 2.00e-08 53.10
IUUC-Mpo-057448 Magnaporthe poae 26.67 4.00e-09 55.10
IUUC-Mtr-058008 Medicago truncatula 60.61 1.00e-123 434.00
IUUC-Mla-058994 Melampsora laricipopulina 27.81 4.00e-09 55.80
IUUC-Mga-059979 Meleagris gallopavo 35.40 5.00e-23 101.00
IUUC-Mvi-060524 Microbotryum violaceum 28.72 4.00e-14 72.40
IUUC-Mmr-061163 Microcebus murinus 37.80 3.00e-21 95.10
IUUC-Mdo-062767 Monodelphis domestica 36.02 6.00e-25 107.00
IUUC-Mmu-064355 Mus musculus 35.80 2.00e-24 105.00
IUUC-Mac-064946 Musa acuminata 70.34 8.00e-129 452.00
IUUC-Mpu-066278 Mustela putorius furo 36.02 3.00e-24 105.00
IUUC-Mlu-068028 Myotis lucifugus 36.65 7.00e-25 107.00
IUUC-Nfi-068607 Neosartorya fischeri 25.61 9.00e-07 47.80
IUUC-Ncr-068733 Neurospora crassa 43.04 1.00e-11 63.90
IUUC-Nle-070061 Nomascus leucogenys 36.02 9.00e-25 107.00
IUUC-Ont-071715 Oreochromis niloticus 34.57 7.00e-23 100.00
IUUC-Oan-073385 Ornithorhynchus anatinus 36.65 3.00e-25 109.00
IUUC-Ocu-074608 Oryctolagus cuniculus 36.02 7.00e-25 107.00
IUUC-Oba-075531 Oryza barthii 68.81 2.00e-119 420.00
IUUC-Obr-076891 Oryza brachyantha 82.87 5.00e-170 588.00
IUUC-Ogl-077925 Oryza glaberrima 84.88 9.00e-164 568.00
IUUC-Ogu-078352 Oryza glumaepatula 68.81 2.00e-119 420.00
IUUC-Oin-080025 Oryza indica 85.32 7.00e-166 575.00
IUUC-Olo-080624 Oryza longistaminata 78.90 7.00e-147 512.00
IUUC-Ome-081745 Oryza meridionalis 85.63 4.00e-166 576.00
IUUC-Oni-082992 Oryza nivara 85.32 2.00e-165 574.00
IUUC-Opu-083594 Oryza punctata 78.79 1.00e-147 514.00
IUUC-Oru-084792 Oryza rufipogon 68.81 1.00e-118 418.00
IUUC-Osa-086272 Oryza sativa 78.08 1.00e-68 251.00
IUUC-Ola-086443 Oryzias latipes 35.19 2.00e-23 102.00
IUUC-Olu-087849 Ostreococcus lucimarinus 31.13 1.00e-35 142.00
IUUC-Oga-087973 Otolemur garnettii 36.57 1.00e-21 97.10
IUUC-Oar-089479 Ovis aries 35.19 4.00e-24 104.00
IUUC-Ptr-091217 Pan troglodytes 36.02 8.00e-25 107.00
IUUC-Pan-092809 Papio anubis 36.02 8.00e-25 107.00
IUUC-Psi-093838 Pelodiscus sinensis 36.02 3.00e-24 105.00
IUUC-Pma-094194 Petromyzon marinus 30.23 1.00e-14 73.90
IUUC-Pno-094974 Phaeosphaeria nodorum 23.76 9.00e-07 47.80
IUUC-Ppa-095612 Physcomitrella patens 58.49 2.00e-110 390.00
IUUC-Pfo-097152 Poecilia formosa 34.57 3.00e-22 98.60
IUUC-Pab-098181 Pongo abelii 36.65 7.00e-25 107.00
IUUC-Pop-098903 Populus trichocarpa 57.80 1.00e-109 388.00
IUUC-Pca-100097 Procavia capensis 36.65 3.00e-25 108.00
IUUC-Ppe-101770 Prunus persica 61.16 3.00e-121 427.00
IUUC-Pva-103016 Pteropus vampyrus 36.02 1.00e-24 106.00
IUUC-Pgr-103565 Puccinia graminis 28.57 2.00e-09 57.00
IUUC-Pte-104397 Pyrenophora teres 30.00 7.00e-06 44.70
IUUC-Rno-104872 Rattus norvegicus 36.42 9.00e-25 107.00
IUUC-Sce-106426 Saccharomyces cerevisiae 26.32 9.00e-07 47.00
IUUC-Sha-106487 Sarcophilus harrisii 35.58 9.00e-24 103.00
IUUC-Sja-107695 Schizosaccharomyces japonicus 30.00 3.00e-15 75.10
IUUC-Spo-108193 Schizosaccharomyces pombe 25.98 4.00e-15 74.70
IUUC-Ssl-108468 Sclerotinia sclerotiorum 24.32 7.00e-09 54.70
IUUC-Smo-109062 Selaginella moellendorffii 51.55 3.00e-96 343.00
IUUC-Sit-110175 Setaria italica 94.46 0.00e+00 647.00
IUUC-Sly-111632 Solanum lycopersicum 62.69 1.00e-117 415.00
IUUC-Stu-112393 Solanum tuberosum 63.30 5.00e-118 416.00
IUUC-Sar-113758 Sorex araneus 34.78 5.00e-24 104.00
IUUC-Sre-115169 Sporisorium reilianum 28.86 2.00e-15 77.00
IUUC-Ssc-116249 Sus scrofa 35.40 1.00e-23 103.00
IUUC-Tgu-117421 Taeniopygia guttata 34.78 7.00e-22 97.80
IUUC-Tru-118114 Takifugu rubripes 31.48 3.00e-20 92.00
IUUC-Tsy-119305 Tarsius syrichta 36.25 6.00e-25 107.00
IUUC-Tni-120491 Tetraodon nigroviridis 30.00 3.00e-19 88.60
IUUC-Tca-120948 Theobroma cacao 61.47 9.00e-126 442.00
IUUC-Tre-121934 Trichoderma reesei 27.75 9.00e-10 57.80
IUUC-Tvi-122432 Trichoderma virens 29.28 2.00e-11 63.20
IUUC-Tae-125443 Triticum aestivum 85.32 2.00e-172 597.00
IUUC-Tur-126459 Triticum urartu 89.42 7.00e-102 361.00
IUUC-Tme-127190 Tuber melanosporum 24.90 2.00e-15 76.60
IUUC-Tbe-127313 Tupaia belangeri 39.68 8.00e-20 90.10
IUUC-Ttr-128471 Tursiops truncatus 35.80 6.00e-25 107.00
IUUC-Uma-129486 Ustilago maydis 27.14 1.00e-13 70.90
IUUC-Vda-129897 Verticillium dahliae 24.88 9.00e-11 60.80
IUUC-Vpa-130277 Vicugna pacos 38.14 1.00e-14 73.20
IUUC-Vvi-130912 Vitis vinifera 60.54 1.00e-117 414.00
IUUC-Xtr-132405 Xenopus tropicalis 34.78 3.00e-23 102.00
IUUC-Xma-133338 Xiphophorus maculatus 35.19 5.00e-23 101.00
IUUC-Yli-134647 Yarrowia lipolytica 46.77 1.00e-10 60.10
IUUC-Zma-135447 Zea mays 98.78 0.00e+00 677.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved