• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
    • COSMIC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Spo-108033
UUCD1 version UUC-ScP-00053
Ensembl Protein ID SPBC409.05.1:pep
UniProt Accession Q9Y709; SKP1_SCHPO
Genbank Protein ID BAA77790.1; BAB62325.1; AAD37024.1; CAB52607.1
Protein Name Suppressor of kinetochore protein 1; P19/Skp1 homolog
Genbank Nucleotide ID AB027472; AB067633; AF071066; CU329671
Gene Name skp1; psh1; sph1; SPBC409.05
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
SPBC409.05 SPBC409.05.1 SPBC409.05.1:pep
Annotation
mRNA Expression
GEO
Protein-protein Interaction
iRefIndexHINTMentha
Protein Expression/Proteomics
Status Reviewed
Details
Family Domain References (PMIDs)
E3 adaptor/Cullin RING/SCF/SKP1 SKP1 15147268
Classification
Family E-value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 5.60e-31 104.6 111 158
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 1    ksLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    k+LLd++cktVa+mi+gk+pe+iRktFni nDftpeEe+++R+En+WA
   Q: 111 KPLLDTGCKTVANMIRGKSPEDIRKTFNIPNDFTPEEEEQIRKENEWA 158
    79*********************************************9 PP
   

Organism Schizosaccharomyces pombe
Functional Description
(View)

Functional Description



     Required for cig2 degradation in the G2 and M phases of the cell cycle. Together with pof6, essential for septum processing and cell separation. Involved in mitotic progression, essential for the execution of anaphase B; required for coordinated structural alterations of mitotic spindles and segregation of nuclear membrane structures at anaphase. Involved in the DNA damage checkpoint pathway and maintenance of genome integrity. Component of the RAVE complex which is required for stable assembly of the vacuolar ATPase complex V-ATPase.
Required for cig2 degradation in the G2 and M phases of the cell cycle. Together with pof6, essential for septum processing and cell separation. Involved in mitotic progression, essential for the execution of anaphase B; required for coordinated structural alterations of mitotic spindles and segregation of nuclear membrane structures at anaphase. Involved in the DNA damage checkpoint pathway and maintenance of genome integrity. Component of the RAVE complex which is required for stable assembly of the vacuolar ATPase complex V-ATPase.
Protein Sequence
(Fasta)
MSKIKLISSD NEEFVVDQLI AERSMLIKNM LEDVGEINVP IPLPNVSSNV LRKVLEWCEH 60
HKNDLYSGTE EESDIRLKKS TDIDEWDRKF MAVDQEMLFE IVLASNYLDI KPLLDTGCKT 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Spo-108033|E3,SKP1|Schizosaccharomyces pombe
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CAGCATAACT AGAAATGCTA ACAGCTTAAC TTTCATTCAT CCATTACTTA CATACATCAA 60
CAATGTCCAA AATCAAACTG ATTTCATCTG ACAATGAAGA GTTCGTGGTC GGTATGTAGA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Spo-108033|E3,SKP1|Schizosaccharomyces pombe
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0131--Cell cycle
KW-0132--Cell division
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0227--DNA damage
KW-0498--Mitosis
KW-0539--Nucleus
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0005829--C:cytosol
GO:0043224--C:nuclear SCF ubiquitin ligase complex
GO:0005634--C:nucleus
GO:0043291--C:RAVE complex
GO:0019005--C:SCF ubiquitin ligase complex
GO:0017117--C:single-stranded DNA-dependent ATP-dependent DNA helicase complex
GO:0061630--F:ubiquitin protein ligase activity
GO:0000920--P:cell separation after cytokinesis
GO:0006974--P:cellular response to DNA damage stimulus
GO:0007067--P:mitotic nuclear division
GO:0045841--P:negative regulation of mitotic metaphase/anaphase transition
GO:0006998--P:nuclear envelope organization
GO:0030163--P:protein catabolic process
GO:0042787--P:protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0007346--P:regulation of mitotic cell cycle
GO:0060542--P:regulation of strand invasion
GO:0031146--P:SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

KEGG spo:SPBC409.05
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000465 Aegilops tauschii 50.97 1.00e-38 150.00
IUUC-Aml-002023 Ailuropoda melanoleuca 56.36 8.00e-43 164.00
IUUC-Atr-002858 Amborella trichopoda 53.21 2.00e-33 132.00
IUUC-Apl-003393 Anas platyrhynchos 56.36 8.00e-43 164.00
IUUC-Aca-004709 Anolis carolinensis 56.36 8.00e-43 164.00
IUUC-Aly-006236 Arabidopsis lyrata 49.69 2.00e-38 149.00
IUUC-Ath-007456 Arabidopsis thaliana 50.32 2.00e-39 152.00
IUUC-Ago-007847 Ashbya gossypii 53.14 3.00e-49 185.00
IUUC-Acl-008178 Aspergillus clavatus 69.18 1.00e-60 223.00
IUUC-Afl-008452 Aspergillus flavus 70.25 3.00e-61 224.00
IUUC-Afu-008785 Aspergillus fumigatus 69.38 3.00e-61 224.00
IUUC-Ani-009312 Aspergillus nidulans 69.87 2.00e-59 219.00
IUUC-Aor-010012 Aspergillus oryzae 70.25 3.00e-61 224.00
IUUC-Ate-010375 Aspergillus terreus 70.32 4.00e-60 221.00
IUUC-Ame-011025 Astyanax mexicanus 56.36 6.00e-43 164.00
IUUC-Bgr-012280 Blumeria graminis 65.07 2.00e-45 172.00
IUUC-Bta-013519 Bos taurus 56.36 8.00e-43 164.00
IUUC-Bci-013888 Botrytis cinerea 67.48 3.00e-41 158.00
IUUC-Bdi-014547 Brachypodium distachyon 49.68 4.00e-32 128.00
IUUC-Bol-015842 Brassica oleracea 51.28 3.00e-37 145.00
IUUC-Bra-017558 Brassica rapa 49.04 4.00e-38 148.00
IUUC-Cel-018653 Caenorhabditis elegans 56.44 6.00e-45 171.00
IUUC-Cja-019785 Callithrix jacchus 56.13 3.00e-38 149.00
IUUC-Cfa-020931 Canis familiaris 56.36 1.00e-42 163.00
IUUC-Cpo-022487 Cavia porcellus 55.76 1.00e-40 156.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 50.94 1.00e-38 150.00
IUUC-Csa-023459 Chlorocebus sabaeus 55.76 2.00e-42 162.00
IUUC-Cho-024854 Choloepus hoffmanni 43.75 6.00e-11 57.80
IUUC-Cin-025538 Ciona intestinalis 53.05 2.00e-40 155.00
IUUC-Csv-025865 Ciona savignyi 53.05 1.00e-42 163.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 68.92 4.00e-55 204.00
IUUC-Cne-027058 Cryptococcus neoformans 65.82 1.00e-59 220.00
IUUC-Cme-027174 Cyanidioschyzon merolae 45.22 1.00e-33 133.00
IUUC-Dre-027756 Danio rerio 56.36 6.00e-43 164.00
IUUC-Dno-028924 Dasypus novemcinctus 56.36 8.00e-43 164.00
IUUC-Dor-030847 Dipodomys ordii 52.44 2.00e-37 146.00
IUUC-Dse-031209 Dothistroma septosporum 70.44 2.00e-60 223.00
IUUC-Dme-032028 Drosophila melanogaster 56.71 1.00e-46 176.00
IUUC-Ete-033117 Echinops telfairi 54.55 2.00e-41 159.00
IUUC-Eca-033320 Equus caballus 56.36 8.00e-43 164.00
IUUC-Eeu-034817 Erinaceus europaeus 59.09 7.00e-11 56.20
IUUC-Fca-035423 Felis catus 56.36 8.00e-43 164.00
IUUC-Fal-036956 Ficedula albicollis 56.36 8.00e-43 164.00
IUUC-Fox-037761 Fusarium oxysporum 69.39 4.00e-56 208.00
IUUC-Fso-038451 Fusarium solani 66.89 3.00e-56 208.00
IUUC-Gmo-039178 Gadus morhua 56.36 8.00e-43 164.00
IUUC-Ggr-039831 Gaeumannomyces graminis 65.54 1.00e-53 199.00
IUUC-Gga-040238 Gallus gallus 56.36 8.00e-43 164.00
IUUC-Gac-041965 Gasterosteus aculeatus 56.36 8.00e-43 164.00
IUUC-Gma-043086 Glycine max 51.92 2.00e-36 142.00
IUUC-Ggo-045025 Gorilla gorilla 56.36 8.00e-43 164.00
IUUC-Hsa-046875 Homo sapiens 56.36 8.00e-43 164.00
IUUC-Hvu-047497 Hordeum vulgare 48.72 3.00e-34 135.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 55.15 3.00e-42 162.00
IUUC-Kpa-049138 Komagataella pastoris 54.05 7.00e-51 191.00
IUUC-Lch-050522 Latimeria chalumnae 55.83 2.00e-45 172.00
IUUC-Lpe-051330 Leersia perrieri 50.00 4.00e-39 151.00
IUUC-Loc-052596 Lepisosteus oculatus 56.36 8.00e-43 164.00
IUUC-Lma-053020 Leptosphaeria maculans 65.03 3.00e-45 172.00
IUUC-Laf-053847 Loxodonta africana 56.36 8.00e-43 164.00
IUUC-Mor-057176 Magnaporthe oryzae 66.89 8.00e-55 204.00
IUUC-Mpo-057471 Magnaporthe poae 65.54 1.00e-53 199.00
IUUC-Mtr-058458 Medicago truncatula 45.51 2.00e-37 146.00
IUUC-Mla-059153 Melampsora laricipopulina 70.25 9.00e-61 223.00
IUUC-Mga-059864 Meleagris gallopavo 56.36 8.00e-43 164.00
IUUC-Mvi-060342 Microbotryum violaceum 70.62 1.00e-63 233.00
IUUC-Mdo-062509 Monodelphis domestica 56.36 8.00e-43 164.00
IUUC-Mmu-063694 Mus musculus 56.36 8.00e-43 164.00
IUUC-Mac-064626 Musa acuminata 50.94 1.00e-35 140.00
IUUC-Mpu-065990 Mustela putorius furo 56.36 8.00e-43 164.00
IUUC-Mlu-068168 Myotis lucifugus 56.36 8.00e-43 164.00
IUUC-Nfi-068309 Neosartorya fischeri 69.38 3.00e-61 224.00
IUUC-Ncr-068658 Neurospora crassa 66.89 3.00e-55 205.00
IUUC-Nle-070101 Nomascus leucogenys 56.36 8.00e-43 164.00
IUUC-Opr-070881 Ochotona princeps 56.36 8.00e-43 164.00
IUUC-Ont-071529 Oreochromis niloticus 56.36 8.00e-43 164.00
IUUC-Oan-073000 Ornithorhynchus anatinus 74.14 3.00e-23 97.40
IUUC-Ocu-073780 Oryctolagus cuniculus 56.36 8.00e-43 164.00
IUUC-Oba-075110 Oryza barthii 47.10 8.00e-35 137.00
IUUC-Obr-076716 Oryza brachyantha 48.17 6.00e-34 134.00
IUUC-Ogl-077257 Oryza glaberrima 51.61 8.00e-39 150.00
IUUC-Ogu-078813 Oryza glumaepatula 49.36 3.00e-35 138.00
IUUC-Oin-080141 Oryza indica 51.61 8.00e-39 150.00
IUUC-Olo-080834 Oryza longistaminata 41.40 8.00e-33 130.00
IUUC-Ome-081330 Oryza meridionalis 44.24 3.00e-31 125.00
IUUC-Oni-082067 Oryza nivara 50.34 8.00e-36 140.00
IUUC-Opu-083927 Oryza punctata 48.39 2.00e-31 126.00
IUUC-Oru-084769 Oryza rufipogon 47.10 3.00e-35 139.00
IUUC-Osa-085479 Oryza sativa 47.10 3.00e-35 139.00
IUUC-Ola-087270 Oryzias latipes 56.36 8.00e-43 164.00
IUUC-Olu-087667 Ostreococcus lucimarinus 52.20 1.00e-41 159.00
IUUC-Oga-089073 Otolemur garnettii 56.36 8.00e-43 164.00
IUUC-Oar-089391 Ovis aries 51.55 4.00e-37 144.00
IUUC-Ptr-090872 Pan troglodytes 54.27 4.00e-41 158.00
IUUC-Pan-091780 Papio anubis 56.36 8.00e-43 164.00
IUUC-Psi-093135 Pelodiscus sinensis 56.36 8.00e-43 164.00
IUUC-Pno-094810 Phaeosphaeria nodorum 62.50 3.00e-44 168.00
IUUC-Ppa-095244 Physcomitrella patens 53.85 8.00e-41 157.00
IUUC-Pfo-097529 Poecilia formosa 56.36 8.00e-43 164.00
IUUC-Pab-098533 Pongo abelii 56.36 8.00e-43 164.00
IUUC-Pop-099897 Populus trichocarpa 53.16 3.00e-39 152.00
IUUC-Pca-100783 Procavia capensis 47.27 4.00e-32 128.00
IUUC-Ppe-101410 Prunus persica 50.63 1.00e-40 156.00
IUUC-Pva-102901 Pteropus vampyrus 56.36 8.00e-43 164.00
IUUC-Pgr-103499 Puccinia graminis 68.59 5.00e-60 221.00
IUUC-Ptt-103874 Puccinia triticina 71.54 2.00e-52 196.00
IUUC-Pte-104224 Pyrenophora teres 63.64 7.00e-41 157.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 63.64 9.00e-41 157.00
IUUC-Rno-105499 Rattus norvegicus 56.36 8.00e-43 164.00
IUUC-Sce-106387 Saccharomyces cerevisiae 48.45 3.00e-48 182.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 86.34 6.00e-84 300.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 67.12 2.00e-55 205.00
IUUC-Smo-109307 Selaginella moellendorffii 52.23 2.00e-39 152.00
IUUC-Sit-110435 Setaria italica 47.80 5.00e-32 128.00
IUUC-Sly-111529 Solanum lycopersicum 51.61 2.00e-35 139.00
IUUC-Stu-112023 Solanum tuberosum 51.61 3.00e-35 138.00
IUUC-Sar-112973 Sorex araneus 51.52 7.00e-35 137.00
IUUC-Sbi-114666 Sorghum bicolor 50.94 4.00e-35 138.00
IUUC-Sre-115178 Sporisorium reilianum 67.09 3.00e-62 228.00
IUUC-Tgu-116474 Taeniopygia guttata 56.36 8.00e-43 164.00
IUUC-Tru-118429 Takifugu rubripes 56.36 8.00e-43 164.00
IUUC-Tsy-118896 Tarsius syrichta 56.36 8.00e-43 164.00
IUUC-Tni-119960 Tetraodon nigroviridis 56.36 8.00e-43 164.00
IUUC-Tca-121022 Theobroma cacao 52.56 5.00e-36 141.00
IUUC-Tre-122004 Trichoderma reesei 65.07 6.00e-50 187.00
IUUC-Tvi-122449 Trichoderma virens 65.75 5.00e-50 187.00
IUUC-Tae-123642 Triticum aestivum 48.78 3.00e-38 148.00
IUUC-Tur-126200 Triticum urartu 51.28 6.00e-39 150.00
IUUC-Tme-127078 Tuber melanosporum 71.43 2.00e-60 222.00
IUUC-Tbe-127720 Tupaia belangeri 56.36 8.00e-43 164.00
IUUC-Ttr-129035 Tursiops truncatus 56.36 8.00e-43 164.00
IUUC-Uma-129517 Ustilago maydis 67.09 5.00e-61 224.00
IUUC-Vda-129691 Verticillium dahliae 66.20 1.00e-50 190.00
IUUC-Vpa-130128 Vicugna pacos 56.36 9.00e-43 163.00
IUUC-Vvi-130876 Vitis vinifera 51.61 5.00e-41 157.00
IUUC-Xtr-132393 Xenopus tropicalis 56.36 8.00e-43 164.00
IUUC-Xma-133603 Xiphophorus maculatus 56.36 8.00e-43 164.00
IUUC-Yli-134499 Yarrowia lipolytica 67.08 5.00e-59 217.00
IUUC-Zma-135000 Zea mays 47.13 1.00e-33 133.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved