• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Apl-004018
Ensembl Protein ID ENSAPLP00000006733.1
UniProt Accession U3IHL1; U3IHL1_ANAPL
Genbank Protein ID ENSAPLP00000006733
Protein Name Uncharacterized protein
Genbank Nucleotide ID ADON01108382
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSAPLG00000007107.1 ENSAPLT00000007382.1 ENSAPLP00000006733.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 7.60e-19 67.1 13 47
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGnp+++g+CSkC+ree++++r
   Q: 13 DQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKAR 47
    79*******************************86 PP
   

Organism Anas platyrhynchos
Protein Sequence
(Fasta)
MNLKSERRGI HVDQSELLCK KGCGYYGNPA WQGFCSKCWR EEYHKARQKQ IQEDWELAER 60
LQREEEEAYA SSQSTQGAQS LTFSKFEEKK TNEKTRKVTT VKKFFTASSR AGAKKEIQES 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Apl-004018|UBD,ZnF_A20|Anas platyrhynchos
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGAACCTGA AATCTGAACG CAGAGGAATT CACGTTGATC AGTCGGAGCT CCTGTGCAAG 60
AAGGGATGTG GTTACTATGG CAATCCTGCT TGGCAGGGCT TTTGCTCCAA GTGCTGGAGA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Apl-004018|UBD,ZnF_A20|Anas platyrhynchos
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0031982--C:vesicle
GO:0003677--F:DNA binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 29.41 5.00e-21 95.50
IUUC-Aml-001771 Ailuropoda melanoleuca 77.58 0.00e+00 787.00
IUUC-Atr-003154 Amborella trichopoda 31.97 4.00e-24 105.00
IUUC-Aca-005227 Anolis carolinensis 26.29 1.00e-09 58.20
IUUC-Aly-006138 Arabidopsis lyrata 31.78 6.00e-26 111.00
IUUC-Ath-006747 Arabidopsis thaliana 31.80 9.00e-26 111.00
IUUC-Ago-007776 Ashbya gossypii 29.58 2.00e-22 99.80
IUUC-Acl-008235 Aspergillus clavatus 31.60 3.00e-28 120.00
IUUC-Afl-008570 Aspergillus flavus 31.89 6.00e-30 125.00
IUUC-Afu-008815 Aspergillus fumigatus 31.60 3.00e-28 120.00
IUUC-Ani-009381 Aspergillus nidulans 31.29 3.00e-28 119.00
IUUC-Ang-009615 Aspergillus niger 30.61 4.00e-30 125.00
IUUC-Aor-010195 Aspergillus oryzae 31.56 1.00e-30 127.00
IUUC-Ate-010514 Aspergillus terreus 32.38 1.00e-29 124.00
IUUC-Ame-011365 Astyanax mexicanus 66.40 0.00e+00 669.00
IUUC-Bgr-012102 Blumeria graminis 29.32 1.00e-28 121.00
IUUC-Bta-013124 Bos taurus 92.07 0.00e+00 847.00
IUUC-Bci-013943 Botrytis cinerea 31.64 9.00e-29 122.00
IUUC-Bdi-014539 Brachypodium distachyon 32.94 2.00e-27 116.00
IUUC-Bol-016580 Brassica oleracea 34.40 8.00e-31 127.00
IUUC-Bra-017843 Brassica rapa 34.62 4.00e-31 129.00
IUUC-Cel-018199 Caenorhabditis elegans 34.27 6.00e-57 214.00
IUUC-Cja-019941 Callithrix jacchus 91.87 0.00e+00 844.00
IUUC-Cfa-020845 Canis familiaris 91.11 0.00e+00 769.00
IUUC-Cpo-022037 Cavia porcellus 91.26 0.00e+00 836.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 32.95 1.00e-21 97.10
IUUC-Csa-023272 Chlorocebus sabaeus 90.65 0.00e+00 835.00
IUUC-Cho-025076 Choloepus hoffmanni 81.30 0.00e+00 709.00
IUUC-Cin-025400 Ciona intestinalis 45.18 1.00e-115 409.00
IUUC-Csv-025941 Ciona savignyi 37.83 5.00e-86 311.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 30.18 2.00e-26 114.00
IUUC-Cne-027057 Cryptococcus neoformans 31.97 5.00e-34 139.00
IUUC-Dre-028484 Danio rerio 70.36 0.00e+00 673.00
IUUC-Dno-028906 Dasypus novemcinctus 91.68 0.00e+00 830.00
IUUC-Dor-030124 Dipodomys ordii 82.28 0.00e+00 721.00
IUUC-Dse-031437 Dothistroma septosporum 27.70 2.00e-24 107.00
IUUC-Dme-031696 Drosophila melanogaster 34.52 2.00e-69 256.00
IUUC-Ete-032573 Echinops telfairi 86.97 0.00e+00 681.00
IUUC-Eca-033711 Equus caballus 91.87 0.00e+00 857.00
IUUC-Eeu-034459 Erinaceus europaeus 91.67 3.00e-70 259.00
IUUC-Fca-035447 Felis catus 89.43 0.00e+00 855.00
IUUC-Fal-036605 Ficedula albicollis 93.65 0.00e+00 846.00
IUUC-Fox-037967 Fusarium oxysporum 27.54 9.00e-18 85.10
IUUC-Fso-038110 Fusarium solani 30.39 7.00e-28 119.00
IUUC-Gmo-038785 Gadus morhua 65.68 0.00e+00 670.00
IUUC-Ggr-039760 Gaeumannomyces graminis 30.80 3.00e-26 113.00
IUUC-Gga-040584 Gallus gallus 97.97 0.00e+00 913.00
IUUC-Gac-042317 Gasterosteus aculeatus 62.13 7.00e-161 559.00
IUUC-Gma-044237 Glycine max 36.87 4.00e-26 112.00
IUUC-Ggo-044498 Gorilla gorilla 79.72 0.00e+00 703.00
IUUC-Hsa-046625 Homo sapiens 91.46 0.00e+00 841.00
IUUC-Hvu-047155 Hordeum vulgare 32.16 3.00e-27 115.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 90.45 0.00e+00 841.00
IUUC-Kpa-049160 Komagataella pastoris 31.69 2.00e-24 106.00
IUUC-Lch-050529 Latimeria chalumnae 78.73 0.00e+00 867.00
IUUC-Lpe-051024 Leersia perrieri 31.08 7.00e-30 124.00
IUUC-Loc-052644 Lepisosteus oculatus 68.40 0.00e+00 662.00
IUUC-Lma-053102 Leptosphaeria maculans 31.50 8.00e-26 112.00
IUUC-Laf-054337 Loxodonta africana 89.63 0.00e+00 844.00
IUUC-Mcc-055659 Macaca mulatta 90.91 8.00e-169 586.00
IUUC-Meu-056084 Macropus eugenii 75.11 7.00e-93 334.00
IUUC-Mor-057255 Magnaporthe oryzae 29.71 9.00e-26 111.00
IUUC-Mpo-057454 Magnaporthe poae 30.80 4.00e-28 119.00
IUUC-Mtr-058098 Medicago truncatula 33.96 3.00e-32 132.00
IUUC-Mla-059068 Melampsora laricipopulina 31.09 4.00e-30 125.00
IUUC-Mga-059624 Meleagris gallopavo 83.56 0.00e+00 904.00
IUUC-Mvi-060282 Microbotryum violaceum 28.79 1.00e-25 112.00
IUUC-Mmr-061142 Microcebus murinus 92.07 0.00e+00 867.00
IUUC-Mdo-062289 Monodelphis domestica 89.63 0.00e+00 874.00
IUUC-Mmu-063961 Mus musculus 90.85 0.00e+00 837.00
IUUC-Mac-065188 Musa acuminata 32.68 2.00e-25 109.00
IUUC-Mpu-066291 Mustela putorius furo 91.28 0.00e+00 836.00
IUUC-Mlu-067431 Myotis lucifugus 88.24 0.00e+00 820.00
IUUC-Nfi-068422 Neosartorya fischeri 31.46 2.00e-29 124.00
IUUC-Ncr-068843 Neurospora crassa 30.18 2.00e-27 117.00
IUUC-Nle-069079 Nomascus leucogenys 91.26 0.00e+00 838.00
IUUC-Opr-070790 Ochotona princeps 90.74 2.00e-54 206.00
IUUC-Ont-071789 Oreochromis niloticus 68.20 3.00e-179 620.00
IUUC-Oan-072946 Ornithorhynchus anatinus 87.45 0.00e+00 801.00
IUUC-Ocu-073816 Oryctolagus cuniculus 91.48 0.00e+00 836.00
IUUC-Oba-075738 Oryza barthii 30.43 2.00e-19 89.70
IUUC-Obr-076355 Oryza brachyantha 33.33 2.00e-28 119.00
IUUC-Ogl-077217 Oryza glaberrima 32.95 4.00e-26 112.00
IUUC-Ogu-078197 Oryza glumaepatula 28.74 3.00e-28 118.00
IUUC-Oin-080047 Oryza indica 33.60 1.00e-27 117.00
IUUC-Olo-080317 Oryza longistaminata 28.74 4.00e-28 118.00
IUUC-Ome-081589 Oryza meridionalis 32.55 3.00e-28 119.00
IUUC-Oni-082700 Oryza nivara 30.43 1.00e-19 90.50
IUUC-Opu-083923 Oryza punctata 33.13 2.00e-21 95.50
IUUC-Oru-084318 Oryza rufipogon 30.43 1.00e-19 90.50
IUUC-Osa-086246 Oryza sativa 38.98 5.00e-06 41.60
IUUC-Ola-086730 Oryzias latipes 56.76 6.00e-150 523.00
IUUC-Olu-087719 Ostreococcus lucimarinus 32.97 1.00e-23 103.00
IUUC-Oga-088992 Otolemur garnettii 80.32 0.00e+00 859.00
IUUC-Oar-089789 Ovis aries 92.29 0.00e+00 850.00
IUUC-Ptr-091636 Pan troglodytes 91.46 0.00e+00 839.00
IUUC-Pan-092911 Papio anubis 90.85 0.00e+00 836.00
IUUC-Psi-093194 Pelodiscus sinensis 79.69 0.00e+00 863.00
IUUC-Pma-094212 Petromyzon marinus 47.99 5.00e-115 407.00
IUUC-Pno-094831 Phaeosphaeria nodorum 30.04 1.00e-25 111.00
IUUC-Ppa-095705 Physcomitrella patens 30.59 4.00e-30 125.00
IUUC-Pfo-096694 Poecilia formosa 64.89 8.00e-180 622.00
IUUC-Pab-097706 Pongo abelii 91.26 0.00e+00 838.00
IUUC-Pop-099891 Populus trichocarpa 34.33 2.00e-28 119.00
IUUC-Pca-100879 Procavia capensis 86.45 4.00e-89 320.00
IUUC-Ppe-101334 Prunus persica 31.66 4.00e-28 119.00
IUUC-Pva-103225 Pteropus vampyrus 77.62 0.00e+00 681.00
IUUC-Pgr-103564 Puccinia graminis 29.89 3.00e-29 123.00
IUUC-Ptt-103802 Puccinia triticina 30.12 2.00e-25 110.00
IUUC-Pte-104345 Pyrenophora teres 30.40 8.00e-26 112.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 30.36 2.00e-26 114.00
IUUC-Rno-106101 Rattus norvegicus 91.26 0.00e+00 842.00
IUUC-Sce-106460 Saccharomyces cerevisiae 30.63 3.00e-24 105.00
IUUC-Sha-106919 Sarcophilus harrisii 77.07 0.00e+00 826.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 32.66 7.00e-29 121.00
IUUC-Spo-108087 Schizosaccharomyces pombe 30.74 1.00e-27 117.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 29.82 1.00e-07 51.60
IUUC-Smo-109411 Selaginella moellendorffii 33.86 4.00e-31 129.00
IUUC-Sit-110678 Setaria italica 32.16 8.00e-28 117.00
IUUC-Sly-111526 Solanum lycopersicum 37.29 1.00e-25 110.00
IUUC-Stu-112494 Solanum tuberosum 37.85 3.00e-26 112.00
IUUC-Sar-112929 Sorex araneus 95.29 5.00e-159 554.00
IUUC-Sbi-114242 Sorghum bicolor 31.43 8.00e-31 127.00
IUUC-Sre-115224 Sporisorium reilianum 32.38 3.00e-30 127.00
IUUC-Ssc-115239 Sus scrofa 91.48 0.00e+00 840.00
IUUC-Tgu-117499 Taeniopygia guttata 95.73 0.00e+00 896.00
IUUC-Tru-118027 Takifugu rubripes 59.81 3.00e-166 577.00
IUUC-Tsy-119462 Tarsius syrichta 91.19 0.00e+00 833.00
IUUC-Tni-120855 Tetraodon nigroviridis 63.62 5.00e-175 606.00
IUUC-Tca-121213 Theobroma cacao 31.89 9.00e-27 114.00
IUUC-Tre-122186 Trichoderma reesei 30.64 1.00e-27 117.00
IUUC-Tvi-122541 Trichoderma virens 30.61 2.00e-27 117.00
IUUC-Tae-122942 Triticum aestivum 33.33 1.00e-28 120.00
IUUC-Tur-126572 Triticum urartu 33.88 5.00e-27 115.00
IUUC-Tme-127023 Tuber melanosporum 33.60 3.00e-31 130.00
IUUC-Tbe-127453 Tupaia belangeri 90.93 0.00e+00 735.00
IUUC-Ttr-128526 Tursiops truncatus 91.87 0.00e+00 845.00
IUUC-Uma-129660 Ustilago maydis 32.81 4.00e-30 126.00
IUUC-Vda-129737 Verticillium dahliae 29.01 7.00e-24 105.00
IUUC-Vpa-130505 Vicugna pacos 84.20 0.00e+00 666.00
IUUC-Vvi-131088 Vitis vinifera 33.20 3.00e-24 106.00
IUUC-Xtr-132799 Xenopus tropicalis 81.54 0.00e+00 760.00
IUUC-Xma-133345 Xiphophorus maculatus 65.49 1.00e-174 605.00
IUUC-Yli-134416 Yarrowia lipolytica 32.35 1.00e-31 130.00
IUUC-Zma-134750 Zea mays 31.07 7.00e-28 118.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved