• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • HPM
  • DNA & RNA Element
    • UTRdb
    • AREsite
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • TargetScan
    • RepTar
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
  • Disease
    • ClinVar
    • GWASdb
    • OMIM
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • Phospho.ELM
    • UniProt
    • PHOSIDA
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Fal-036605
Ensembl Protein ID ENSFALP00000007002.1
UniProt Accession U3JW48; U3JW48_FICAL
Genbank Protein ID ENSFALP00000007002
Protein Name Uncharacterized protein
Genbank Nucleotide ID AGTO01021117
Gene Name RABGEF1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSFALG00000006714.1 ENSFALT00000007033.1 ENSFALP00000007002.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/ZnF/ZnF_A20 7.70e-19 67.0 13 47
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/ZnF/ZnF_A20

   S: 1    dpskllCkkgCgfYGnpetngyCSkCyreelrrrr 35
    d+s+llCkkgCg+YGnp+++g+CSkC+ree++++r
   Q: 13 DQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKAR 47
    79*******************************86 PP
   

Organism Ficedula albicollis
Protein Sequence
(Fasta)
MSLKSERRGI HVDQSELLCK KGCGYYGNPA WQGFCSKCWR EEYHKARQKQ IQEDWELAER 60
LQREEEEAYA SSQSTQGAQS LTFSKFEEKK TNEKTRKVTT VKKFFTASSR AGAKKALAGK 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Fal-036605|UBD,ZnF_A20|Ficedula albicollis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
TGGGACTGTC ACTGGTTCCC TGGACACTCT CTGGAGCTGT GTGAGTGTCA CAGCCCTGCA 60
GAGATGTGCC TTGGCAGTGT GTCCCCTGGT GTGGGACTGT CACTGGTTCC CTGGACACTC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Fal-036605|UBD,ZnF_A20|Ficedula albicollis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003123--VPS9
IPR002653--Znf_A20

PROSITE

PS51205--VPS9
PS51036--ZF_A20

Pfam

PF02204--VPS9
PF01754--zf-A20

SMART

SM00167--VPS9
SM00259--ZnF_A20

Gene Ontology

GO:0031982--C:vesicle
GO:0003677--F:DNA binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0008270--F:zinc ion binding
GO:0050728--P:negative regulation of inflammatory response
GO:1900165--P:negative regulation of interleukin-6 secretion
GO:1900235--P:negative regulation of Kit signaling pathway
GO:0002686--P:negative regulation of leukocyte migration
GO:0043305--P:negative regulation of mast cell degranulation
GO:0001933--P:negative regulation of protein phosphorylation
GO:0046580--P:negative regulation of Ras protein signal transduction
GO:0048261--P:negative regulation of receptor-mediated endocytosis
GO:0060368--P:regulation of Fc receptor mediated stimulatory signaling pathway

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000198 Aegilops tauschii 30.15 1.00e-20 94.40
IUUC-Aml-001771 Ailuropoda melanoleuca 74.51 0.00e+00 740.00
IUUC-Atr-003154 Amborella trichopoda 31.08 1.00e-21 97.40
IUUC-Apl-004018 Anas platyrhynchos 93.65 0.00e+00 858.00
IUUC-Aca-004889 Anolis carolinensis 31.91 2.00e-08 54.30
IUUC-Aly-006138 Arabidopsis lyrata 32.41 3.00e-26 113.00
IUUC-Ath-006747 Arabidopsis thaliana 32.02 6.00e-26 112.00
IUUC-Ago-007776 Ashbya gossypii 29.71 2.00e-23 102.00
IUUC-Acl-008235 Aspergillus clavatus 30.82 1.00e-27 118.00
IUUC-Afl-008570 Aspergillus flavus 31.33 2.00e-30 127.00
IUUC-Afu-008815 Aspergillus fumigatus 31.53 5.00e-28 119.00
IUUC-Ani-009381 Aspergillus nidulans 30.80 1.00e-28 121.00
IUUC-Ang-009615 Aspergillus niger 29.79 2.00e-30 126.00
IUUC-Aor-010195 Aspergillus oryzae 31.00 3.00e-31 129.00
IUUC-Ate-010514 Aspergillus terreus 32.14 4.00e-29 122.00
IUUC-Ame-011365 Astyanax mexicanus 64.71 0.00e+00 637.00
IUUC-Bgr-012102 Blumeria graminis 27.97 2.00e-28 120.00
IUUC-Bta-013124 Bos taurus 88.71 0.00e+00 795.00
IUUC-Bci-013943 Botrytis cinerea 31.39 2.00e-28 120.00
IUUC-Bdi-014539 Brachypodium distachyon 34.12 2.00e-27 116.00
IUUC-Bol-016580 Brassica oleracea 34.66 4.00e-31 129.00
IUUC-Bra-017843 Brassica rapa 34.92 2.00e-31 129.00
IUUC-Cel-018199 Caenorhabditis elegans 32.83 8.00e-57 214.00
IUUC-Cja-019941 Callithrix jacchus 88.50 0.00e+00 792.00
IUUC-Cfa-020845 Canis familiaris 87.69 0.00e+00 722.00
IUUC-Cpo-022037 Cavia porcellus 87.68 0.00e+00 785.00
IUUC-Cre-022696 Chlamydomonas reinhardtii 34.66 1.00e-21 97.40
IUUC-Csa-023495 Chlorocebus sabaeus 88.09 0.00e+00 789.00
IUUC-Cho-025076 Choloepus hoffmanni 88.31 1.00e-163 569.00
IUUC-Cin-025400 Ciona intestinalis 44.76 1.00e-112 399.00
IUUC-Csv-025941 Ciona savignyi 38.89 1.00e-87 317.00
IUUC-Cgl-026725 Colletotrichum gloeosporioides 29.73 5.00e-28 119.00
IUUC-Cne-027057 Cryptococcus neoformans 32.28 1.00e-32 134.00
IUUC-Dre-028484 Danio rerio 66.87 0.00e+00 638.00
IUUC-Dno-028906 Dasypus novemcinctus 88.71 0.00e+00 786.00
IUUC-Dor-030124 Dipodomys ordii 79.42 0.00e+00 671.00
IUUC-Dse-031437 Dothistroma septosporum 27.80 7.00e-25 108.00
IUUC-Dme-031696 Drosophila melanogaster 34.50 8.00e-71 261.00
IUUC-Ete-032573 Echinops telfairi 84.30 0.00e+00 636.00
IUUC-Eca-033711 Equus caballus 88.30 0.00e+00 803.00
IUUC-Eeu-034459 Erinaceus europaeus 61.68 4.00e-67 248.00
IUUC-Fca-035447 Felis catus 86.04 0.00e+00 803.00
IUUC-Fox-037967 Fusarium oxysporum 27.27 9.00e-19 88.60
IUUC-Fso-038110 Fusarium solani 30.25 4.00e-29 122.00
IUUC-Gmo-038785 Gadus morhua 64.34 0.00e+00 644.00
IUUC-Ggr-039760 Gaeumannomyces graminis 30.18 1.00e-27 118.00
IUUC-Gga-040584 Gallus gallus 94.46 0.00e+00 868.00
IUUC-Gac-042317 Gasterosteus aculeatus 60.85 3.00e-160 558.00
IUUC-Gma-044237 Glycine max 36.87 2.00e-25 109.00
IUUC-Ggo-044498 Gorilla gorilla 76.80 0.00e+00 658.00
IUUC-Hsa-046625 Homo sapiens 88.09 0.00e+00 788.00
IUUC-Hvu-047155 Hordeum vulgare 33.33 4.00e-27 115.00
IUUC-Itr-048753 Ictidomys tridecemlineatus 87.47 0.00e+00 792.00
IUUC-Kpa-049160 Komagataella pastoris 29.72 1.00e-23 104.00
IUUC-Lch-050529 Latimeria chalumnae 77.65 0.00e+00 835.00
IUUC-Lpe-051024 Leersia perrieri 34.12 4.00e-28 119.00
IUUC-Loc-052644 Lepisosteus oculatus 68.06 0.00e+00 638.00
IUUC-Lma-053102 Leptosphaeria maculans 31.25 1.00e-25 112.00
IUUC-Laf-054337 Loxodonta africana 86.04 0.00e+00 791.00
IUUC-Mcc-055659 Macaca mulatta 88.11 1.00e-165 575.00
IUUC-Meu-056084 Macropus eugenii 72.73 8.00e-83 300.00
IUUC-Mor-057255 Magnaporthe oryzae 29.82 3.00e-27 116.00
IUUC-Mpo-057454 Magnaporthe poae 30.91 1.00e-29 124.00
IUUC-Mtr-058098 Medicago truncatula 34.23 8.00e-32 131.00
IUUC-Mla-059068 Melampsora laricipopulina 30.68 9.00e-31 127.00
IUUC-Mga-059624 Meleagris gallopavo 80.10 0.00e+00 853.00
IUUC-Mvi-060282 Microbotryum violaceum 28.40 2.00e-26 114.00
IUUC-Mmr-061142 Microcebus murinus 88.71 0.00e+00 815.00
IUUC-Mdo-062289 Monodelphis domestica 86.65 0.00e+00 825.00
IUUC-Mmu-063961 Mus musculus 87.47 0.00e+00 786.00
IUUC-Mac-065188 Musa acuminata 33.46 2.00e-24 106.00
IUUC-Mpu-066291 Mustela putorius furo 87.89 0.00e+00 790.00
IUUC-Mlu-067431 Myotis lucifugus 84.60 0.00e+00 771.00
IUUC-Nfi-068422 Neosartorya fischeri 30.67 2.00e-29 124.00
IUUC-Ncr-068843 Neurospora crassa 28.86 5.00e-29 122.00
IUUC-Nle-069079 Nomascus leucogenys 87.89 0.00e+00 786.00
IUUC-Opr-070790 Ochotona princeps 77.78 9.00e-48 184.00
IUUC-Ont-071789 Oreochromis niloticus 67.22 1.00e-178 619.00
IUUC-Oan-072946 Ornithorhynchus anatinus 85.66 0.00e+00 765.00
IUUC-Ocu-073816 Oryctolagus cuniculus 88.50 0.00e+00 790.00
IUUC-Oba-075738 Oryza barthii 31.62 2.00e-19 89.70
IUUC-Obr-076355 Oryza brachyantha 33.87 1.00e-27 117.00
IUUC-Ogl-077217 Oryza glaberrima 34.11 5.00e-26 112.00
IUUC-Ogu-078197 Oryza glumaepatula 30.71 3.00e-29 122.00
IUUC-Oin-080047 Oryza indica 34.78 1.00e-27 117.00
IUUC-Olo-080317 Oryza longistaminata 30.71 3.00e-29 122.00
IUUC-Ome-081589 Oryza meridionalis 33.73 5.00e-28 119.00
IUUC-Oni-082700 Oryza nivara 31.62 2.00e-19 90.10
IUUC-Opu-083923 Oryza punctata 33.74 6.00e-21 94.40
IUUC-Oru-084318 Oryza rufipogon 31.62 2.00e-19 90.10
IUUC-Osa-086246 Oryza sativa 38.98 1.00e-06 43.90
IUUC-Ola-086730 Oryzias latipes 53.09 3.00e-150 524.00
IUUC-Olu-087719 Ostreococcus lucimarinus 33.15 2.00e-23 103.00
IUUC-Oga-088992 Otolemur garnettii 77.62 0.00e+00 814.00
IUUC-Oar-089789 Ovis aries 88.93 0.00e+00 794.00
IUUC-Ptr-091636 Pan troglodytes 88.09 0.00e+00 787.00
IUUC-Pan-092911 Papio anubis 87.89 0.00e+00 787.00
IUUC-Psi-093194 Pelodiscus sinensis 77.02 0.00e+00 818.00
IUUC-Pma-094212 Petromyzon marinus 46.34 7.00e-114 403.00
IUUC-Pno-094831 Phaeosphaeria nodorum 29.78 2.00e-25 111.00
IUUC-Ppa-095705 Physcomitrella patens 30.98 3.00e-29 122.00
IUUC-Pfo-096694 Poecilia formosa 63.94 2.00e-172 598.00
IUUC-Pab-097706 Pongo abelii 87.89 0.00e+00 786.00
IUUC-Pop-099891 Populus trichocarpa 33.21 2.00e-26 114.00
IUUC-Pca-100879 Procavia capensis 81.45 1.00e-85 309.00
IUUC-Ppe-101334 Prunus persica 32.17 5.00e-28 118.00
IUUC-Pva-103225 Pteropus vampyrus 81.50 2.00e-153 535.00
IUUC-Pgr-103564 Puccinia graminis 29.89 7.00e-30 125.00
IUUC-Ptt-103802 Puccinia triticina 45.61 6.00e-25 108.00
IUUC-Pte-104345 Pyrenophora teres 30.15 1.00e-25 111.00
IUUC-Pyt-104716 Pyrenophora triticirepentis 30.11 3.00e-26 114.00
IUUC-Rno-106101 Rattus norvegicus 87.89 0.00e+00 790.00
IUUC-Sce-106460 Saccharomyces cerevisiae 32.69 4.00e-27 115.00
IUUC-Sha-106919 Sarcophilus harrisii 74.87 0.00e+00 784.00
IUUC-Sja-107880 Schizosaccharomyces japonicus 30.56 1.00e-30 127.00
IUUC-Spo-108087 Schizosaccharomyces pombe 29.69 2.00e-27 116.00
IUUC-Ssl-108614 Sclerotinia sclerotiorum 29.82 2.00e-07 51.20
IUUC-Smo-109411 Selaginella moellendorffii 34.26 4.00e-30 125.00
IUUC-Sit-110678 Setaria italica 33.33 1.00e-27 117.00
IUUC-Sly-111526 Solanum lycopersicum 37.29 7.00e-25 108.00
IUUC-Stu-112494 Solanum tuberosum 34.00 1.00e-25 110.00
IUUC-Sar-112929 Sorex araneus 93.16 2.00e-147 515.00
IUUC-Sbi-114242 Sorghum bicolor 32.14 1.00e-30 127.00
IUUC-Sre-115224 Sporisorium reilianum 31.79 2.00e-29 124.00
IUUC-Ssc-115239 Sus scrofa 88.50 0.00e+00 795.00
IUUC-Tgu-117499 Taeniopygia guttata 97.95 0.00e+00 895.00
IUUC-Tru-118027 Takifugu rubripes 61.19 4.00e-136 478.00
IUUC-Tsy-119462 Tarsius syrichta 87.92 0.00e+00 784.00
IUUC-Tni-120855 Tetraodon nigroviridis 59.18 4.00e-169 587.00
IUUC-Tca-121213 Theobroma cacao 33.07 8.00e-26 111.00
IUUC-Tre-122186 Trichoderma reesei 30.51 6.00e-29 122.00
IUUC-Tvi-122541 Trichoderma virens 30.48 1.00e-28 121.00
IUUC-Tae-122942 Triticum aestivum 34.51 2.00e-28 120.00
IUUC-Tur-126572 Triticum urartu 34.58 3.00e-26 113.00
IUUC-Tme-127023 Tuber melanosporum 33.33 3.00e-31 129.00
IUUC-Tbe-127453 Tupaia belangeri 86.35 0.00e+00 681.00
IUUC-Ttr-128526 Tursiops truncatus 88.30 0.00e+00 793.00
IUUC-Uma-129660 Ustilago maydis 32.55 8.00e-30 125.00
IUUC-Vda-129737 Verticillium dahliae 29.45 6.00e-25 109.00
IUUC-Vpa-130505 Vicugna pacos 80.31 9.00e-179 619.00
IUUC-Vvi-131088 Vitis vinifera 33.99 2.00e-24 106.00
IUUC-Xtr-132799 Xenopus tropicalis 78.69 0.00e+00 718.00
IUUC-Xma-133345 Xiphophorus maculatus 64.68 2.00e-167 582.00
IUUC-Yli-134416 Yarrowia lipolytica 31.37 3.00e-30 126.00
IUUC-Zma-134750 Zea mays 32.86 1.00e-27 117.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved