• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • Cancer Mutation
    • TCGA
    • ICGC
    • COSMIC
    • CGAP
    • IntOGen
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • TCGA
    • ICGC
    • COSMIC
    • THPA
    • HPM
  • DNA & RNA Element
    • UTRdb
    • circBase
    • circRNADb
    • CircNet
    • miRTarBase
    • microRNA
    • TRANSFAC
    • miRWalk
    • RepTar
    • miRNAMap
    • SomamiR
    • miRcode
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
    • InWeb_IM
  • 3D Structure
    • PDB
    • MMDB
    • SCOP
  • Disease
    • GWASdb
    • OMIM
  • Drug & target
    • DrugBank
    • Manually
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • HPRD
    • UniProt
    • BioGRID
    • mUbiSiDa
  • DNA Methylation
    • TCGA
    • ICGC
  • Proteomics
    • THPA
    • HPM
    • GPMDB

Tag Content
iUUCD ID IUUC-Ont-071426
Ensembl Protein ID ENSONIP00000003837.1
UniProt Accession I3J4P7; I3J4P7_ORENI
Genbank Protein ID ENSONIP00000003837
Protein Name NEDD8-activating enzyme E1 regulatory subunit
Genbank Nucleotide ID AERX01013865
Gene Name nae1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSONIG00000003065.1 ENSONIT00000003838.1 ENSONIP00000003837.1
Status Unreviewed
Classification
Family E-Value Score Start End
E1 7.90e-120 401.2 12 524
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E1

   S: 1    YDRQirlwGeeaqeklksakvllvGagglGcEllKnLvlaGvgsitvvDmdtvevsnlnrqFLfraedvgksKAevaaealkelnpdvn 89
    YDRQ+rlwG+++qe l++a+v+l++a+++G+E+lKnLvl G+g +t+vD++tv+ ++ +++F+++++++gk++A++a e+l+eln+dv+
   Q: 12 YDRQLRLWGDHGQETLENAHVCLINATATGTEILKNLVLPGIGAFTIVDGHTVTGEDAGNNFFLSKDSIGKNRAQAATEHLQELNSDVS 100
    ***************************************************************************************** PP
   S: 90 veaheesiteleeeiv.FfkkfdvVvlaldnrearrkvnrlclnarvpliesgtlGllGqvrviikgltecyscsd...dppqktiPfc 174
    + ++ee +++l +++ Ff +f++V+ + ++++ +++ +++++a+vp++ ++t+Gl+G++r +++++t+++s++d +++++++P
   Q: 101 GNFVEEGPDKLLDNDSeFFHRFTIVIGVQLPESTCLRLGSVLWSASVPFLVCKTYGLIGYMRLVVQEHTVIESHPDnalEDLRLDQPYA 189
    **************999************************************************************************ PP
   S: 175 tlketpn.........aaehtiewavlfnklleeeageeevlekldseekeegkdkvkselks......edeenfeeaieiavkafakt 248
    ++++++ +++++++w+ +++k+le++ +e++++++++++eke++++++++++++ edeenfeeai+++++a+++t
   Q: 190 EFQNHIKsydldsmekKDHSHTPWIIIVAKYLEKWLSEHNGQPPKNYKEKEAFRQLIREGIRKnengvpEDEENFEEAIKNVNTALNPT 278
    *****77777777777************************************************************************* PP
   S: 249 tins.ikqllksfecdivtkskspfwv.............................................................. 274
    i+s +++l++s +c+++t +++ fwv
   Q: 279 KIPSaVEDLFNSEQCKNITAQSPCFWVmlravkefvhnegngslpvrgtipdmiadsqkfinlqnvyrekamqdaaavskhvesllqsv 367
    ***************************************************************************************** PP
   S: 275 .............sfcsnaealqvp...........ekvekdeevvkasap.....lylllralerfekkkgrkpgelsfekdddsavd 334
    fc+na+ l+v ++v+kde+++ +++p +yl+lra++rf ++++r+pg+ ++++++d + +
   Q: 368 gkpaesipekdikLFCKNASFLRVVrcrslaeeysvDTVNKDEITSCMDSPdsemvFYLMLRAVDRFYQQHSRYPGVYNYQVEED-ISK 455
    ***********************6666666666666999999999999999999*******************************.888 PP
   S: 335 lvtaaanlraeslgiepkldddlikeiagniipaiattnavvgGlaaqEviKvvsgkfeplknfflfdae 404
    l++ + +l ++++++ +++dd+i+e++++++++ +t++a++gG aaqE+iK++s++f+p++n+f+++a+
   Q: 456 LKACVNSLL-QEYSLNVNIKDDYIHEFCRYGAAEPHTVSAFLGGSAAQEAIKIISHQFVPFNNTFIYNAM 524
    888777777.*********************************************************997 PP
   

Organism Oreochromis niloticus
Functional Description
(View)

Functional Description



     Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M.
Regulatory subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M.
Protein Sequence
(Fasta)
MASTKASKEQ KYDRQLRLWG DHGQETLENA HVCLINATAT GTEILKNLVL PGIGAFTIVD 60
GHTVTGEDAG NNFFLSKDSI GKNRAQAATE HLQELNSDVS GNFVEEGPDK LLDNDSEFFH 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ont-071426|E1,E1_ThiF|Oreochromis niloticus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CTACATCTAA ACAGACAAAT AAATTAAAAT CCCTAAAAAC TACCCGAAAT CAAATGAAAA 60
AAAAAATACA GAAAATAGTG AGAAGAAAAA GATAAAAGAC GGTCTGCTGA ATATGCACAA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ont-071426|E1,E1_ThiF|Oreochromis niloticus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR030667--APP-BP1
IPR016040--NAD(P)-bd_dom
IPR000594--ThiF_NAD_FAD-bd

Pfam

PF00899--ThiF

Gene Ontology

GO:0019781--F:NEDD8 activating enzyme activity
GO:0045116--P:protein neddylation

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000764 Aegilops tauschii 41.24 6.00e-123 434.00
IUUC-Aml-002333 Ailuropoda melanoleuca 73.45 0.00e+00 852.00
IUUC-Atr-002644 Amborella trichopoda 39.36 4.00e-111 395.00
IUUC-Apl-003446 Anas platyrhynchos 72.25 0.00e+00 806.00
IUUC-Aca-004450 Anolis carolinensis 71.48 0.00e+00 823.00
IUUC-Aly-006187 Arabidopsis lyrata 40.64 2.00e-126 445.00
IUUC-Ath-006692 Arabidopsis thaliana 40.60 8.00e-127 447.00
IUUC-Ago-007900 Ashbya gossypii 26.74 5.00e-42 165.00
IUUC-Acl-008333 Aspergillus clavatus 35.50 3.00e-85 309.00
IUUC-Afl-008529 Aspergillus flavus 36.23 1.00e-88 320.00
IUUC-Afu-009071 Aspergillus fumigatus 35.24 1.00e-85 310.00
IUUC-Ani-009443 Aspergillus nidulans 34.48 1.00e-79 291.00
IUUC-Ang-009669 Aspergillus niger 33.69 6.00e-84 305.00
IUUC-Aor-009914 Aspergillus oryzae 36.38 2.00e-87 317.00
IUUC-Ate-010450 Aspergillus terreus 34.41 3.00e-86 312.00
IUUC-Ame-011183 Astyanax mexicanus 82.55 0.00e+00 957.00
IUUC-Bgr-012111 Blumeria graminis 30.84 1.00e-61 231.00
IUUC-Bta-012583 Bos taurus 73.91 0.00e+00 855.00
IUUC-Bci-013892 Botrytis cinerea 33.27 3.00e-66 246.00
IUUC-Bdi-014592 Brachypodium distachyon 42.02 1.00e-126 446.00
IUUC-Bol-016399 Brassica oleracea 40.84 5.00e-126 444.00
IUUC-Bra-017506 Brassica rapa 39.85 3.00e-121 429.00
IUUC-Cel-018456 Caenorhabditis elegans 35.42 4.00e-95 342.00
IUUC-Cja-020007 Callithrix jacchus 72.93 0.00e+00 846.00
IUUC-Cfa-020324 Canis familiaris 73.53 0.00e+00 853.00
IUUC-Cpo-022248 Cavia porcellus 50.19 2.00e-137 482.00
IUUC-Csa-023149 Chlorocebus sabaeus 71.68 0.00e+00 714.00
IUUC-Cho-024537 Choloepus hoffmanni 61.82 1.00e-175 609.00
IUUC-Cin-025763 Ciona intestinalis 48.21 1.00e-154 539.00
IUUC-Csv-026113 Ciona savignyi 45.02 6.00e-144 504.00
IUUC-Cgl-026428 Colletotrichum gloeosporioides 33.04 5.00e-71 261.00
IUUC-Cne-026884 Cryptococcus neoformans 29.37 1.00e-72 267.00
IUUC-Cme-027210 Cyanidioschyzon merolae 24.89 4.00e-18 86.70
IUUC-Dre-028140 Danio rerio 83.68 0.00e+00 959.00
IUUC-Dno-030033 Dasypus novemcinctus 73.02 0.00e+00 744.00
IUUC-Dor-030513 Dipodomys ordii 51.75 1.00e-86 313.00
IUUC-Dse-031536 Dothistroma septosporum 32.21 2.00e-80 293.00
IUUC-Dme-031683 Drosophila melanogaster 42.62 2.00e-125 442.00
IUUC-Ete-032420 Echinops telfairi 62.60 0.00e+00 687.00
IUUC-Eca-033992 Equus caballus 71.85 0.00e+00 699.00
IUUC-Eeu-034713 Erinaceus europaeus 59.06 3.00e-89 322.00
IUUC-Fca-036548 Felis catus 72.40 0.00e+00 839.00
IUUC-Fal-037600 Ficedula albicollis 70.69 0.00e+00 788.00
IUUC-Fox-038037 Fusarium oxysporum 32.54 4.00e-72 265.00
IUUC-Fso-038387 Fusarium solani 34.12 3.00e-74 272.00
IUUC-Gmo-038562 Gadus morhua 83.74 0.00e+00 956.00
IUUC-Ggr-040005 Gaeumannomyces graminis 35.12 1.00e-74 273.00
IUUC-Gga-041129 Gallus gallus 72.05 0.00e+00 815.00
IUUC-Gac-042558 Gasterosteus aculeatus 88.60 0.00e+00 993.00
IUUC-Gma-043610 Glycine max 38.79 1.00e-116 413.00
IUUC-Ggo-045611 Gorilla gorilla 72.93 0.00e+00 848.00
IUUC-Hsa-046563 Homo sapiens 73.16 0.00e+00 851.00
IUUC-Hvu-047790 Hordeum vulgare 38.29 6.00e-80 291.00
IUUC-Itr-048066 Ictidomys tridecemlineatus 73.35 0.00e+00 845.00
IUUC-Kpa-049309 Komagataella pastoris 33.21 1.00e-78 287.00
IUUC-Lch-050038 Latimeria chalumnae 73.78 0.00e+00 848.00
IUUC-Lpe-051535 Leersia perrieri 40.44 3.00e-109 388.00
IUUC-Loc-051917 Lepisosteus oculatus 77.08 0.00e+00 862.00
IUUC-Lma-053112 Leptosphaeria maculans 34.77 8.00e-87 314.00
IUUC-Laf-053690 Loxodonta africana 73.35 0.00e+00 853.00
IUUC-Mcc-055117 Macaca mulatta 71.67 0.00e+00 832.00
IUUC-Meu-056761 Macropus eugenii 61.28 0.00e+00 676.00
IUUC-Mor-057230 Magnaporthe oryzae 34.55 1.00e-78 287.00
IUUC-Mpo-057514 Magnaporthe poae 34.62 9.00e-74 271.00
IUUC-Mtr-058551 Medicago truncatula 38.39 5.00e-116 411.00
IUUC-Mla-059183 Melampsora laricipopulina 35.20 5.00e-100 358.00
IUUC-Mga-060144 Meleagris gallopavo 70.99 0.00e+00 797.00
IUUC-Mvi-060221 Microbotryum violaceum 33.21 2.00e-79 290.00
IUUC-Mmr-061325 Microcebus murinus 71.24 0.00e+00 826.00
IUUC-Mdo-062532 Monodelphis domestica 75.05 0.00e+00 863.00
IUUC-Mmu-063956 Mus musculus 73.91 0.00e+00 854.00
IUUC-Mac-064521 Musa acuminata 39.11 8.00e-119 421.00
IUUC-Mpu-066716 Mustela putorius furo 72.84 0.00e+00 799.00
IUUC-Mlu-067459 Myotis lucifugus 72.59 0.00e+00 842.00
IUUC-Nfi-068245 Neosartorya fischeri 35.06 2.00e-85 310.00
IUUC-Ncr-068910 Neurospora crassa 33.52 2.00e-73 270.00
IUUC-Nle-070034 Nomascus leucogenys 70.86 0.00e+00 815.00
IUUC-Opr-070552 Ochotona princeps 68.55 0.00e+00 704.00
IUUC-Oan-073389 Ornithorhynchus anatinus 70.50 0.00e+00 662.00
IUUC-Ocu-074911 Oryctolagus cuniculus 73.35 0.00e+00 850.00
IUUC-Oba-075437 Oryza barthii 41.22 6.00e-116 411.00
IUUC-Obr-076684 Oryza brachyantha 41.60 7.00e-111 394.00
IUUC-Ogl-077170 Oryza glaberrima 41.22 6.00e-116 411.00
IUUC-Ogu-078844 Oryza glumaepatula 41.43 8.00e-108 384.00
IUUC-Oin-079105 Oryza indica 41.22 2.00e-115 409.00
IUUC-Olo-080943 Oryza longistaminata 38.68 5.00e-103 368.00
IUUC-Oni-082891 Oryza nivara 38.36 3.00e-109 389.00
IUUC-Opu-083457 Oryza punctata 41.22 7.00e-115 407.00
IUUC-Oru-084960 Oryza rufipogon 38.51 3.00e-104 372.00
IUUC-Osa-085358 Oryza sativa 41.41 4.00e-116 411.00
IUUC-Ola-086420 Oryzias latipes 90.08 0.00e+00 703.00
IUUC-Olu-087625 Ostreococcus lucimarinus 30.40 2.00e-66 246.00
IUUC-Oga-088810 Otolemur garnettii 73.53 0.00e+00 853.00
IUUC-Oar-089196 Ovis aries 73.68 0.00e+00 850.00
IUUC-Ptr-090617 Pan troglodytes 73.35 0.00e+00 853.00
IUUC-Pan-092761 Papio anubis 73.35 0.00e+00 852.00
IUUC-Psi-093191 Pelodiscus sinensis 72.34 0.00e+00 828.00
IUUC-Pma-094380 Petromyzon marinus 62.68 0.00e+00 670.00
IUUC-Pno-095084 Phaeosphaeria nodorum 34.36 3.00e-76 280.00
IUUC-Ppa-095875 Physcomitrella patens 40.45 5.00e-121 427.00
IUUC-Pfo-096467 Poecilia formosa 90.49 0.00e+00 1015.00
IUUC-Pab-098255 Pongo abelii 72.89 0.00e+00 707.00
IUUC-Pop-099722 Populus trichocarpa 40.45 2.00e-123 436.00
IUUC-Pca-100807 Procavia capensis 61.89 3.00e-94 338.00
IUUC-Ppe-101280 Prunus persica 39.36 1.00e-121 430.00
IUUC-Pva-102333 Pteropus vampyrus 71.05 0.00e+00 806.00
IUUC-Pgr-103401 Puccinia graminis 30.18 2.00e-78 286.00
IUUC-Ptt-103889 Puccinia triticina 26.13 2.00e-56 213.00
IUUC-Pte-104355 Pyrenophora teres 35.55 6.00e-87 315.00
IUUC-Pyt-104545 Pyrenophora triticirepentis 35.19 1.00e-87 317.00
IUUC-Rno-105810 Rattus norvegicus 73.53 0.00e+00 843.00
IUUC-Sce-106397 Saccharomyces cerevisiae 25.51 7.00e-35 141.00
IUUC-Sha-106770 Sarcophilus harrisii 76.62 8.00e-131 459.00
IUUC-Sja-107926 Schizosaccharomyces japonicus 34.17 1.00e-79 290.00
IUUC-Spo-108276 Schizosaccharomyces pombe 33.90 5.00e-82 298.00
IUUC-Ssl-108387 Sclerotinia sclerotiorum 34.13 3.00e-70 259.00
IUUC-Smo-109296 Selaginella moellendorffii 41.02 2.00e-119 422.00
IUUC-Sit-110157 Setaria italica 42.40 3.00e-130 458.00
IUUC-Sly-111105 Solanum lycopersicum 38.67 1.00e-119 423.00
IUUC-Stu-112469 Solanum tuberosum 38.86 2.00e-120 426.00
IUUC-Sar-113083 Sorex araneus 55.23 2.00e-171 595.00
IUUC-Sbi-113813 Sorghum bicolor 42.16 3.00e-128 452.00
IUUC-Sre-115058 Sporisorium reilianum 36.67 4.00e-78 286.00
IUUC-Tgu-116772 Taeniopygia guttata 70.59 0.00e+00 794.00
IUUC-Tru-118686 Takifugu rubripes 88.56 0.00e+00 1006.00
IUUC-Tsy-119111 Tarsius syrichta 70.14 7.00e-116 410.00
IUUC-Tni-120231 Tetraodon nigroviridis 80.78 0.00e+00 900.00
IUUC-Tca-121491 Theobroma cacao 39.17 5.00e-116 411.00
IUUC-Tre-122103 Trichoderma reesei 34.57 2.00e-79 290.00
IUUC-Tvi-122672 Trichoderma virens 34.32 3.00e-74 272.00
IUUC-Tae-125950 Triticum aestivum 42.21 2.00e-125 442.00
IUUC-Tur-126487 Triticum urartu 40.49 1.00e-118 420.00
IUUC-Tme-127097 Tuber melanosporum 37.32 1.00e-94 340.00
IUUC-Ttr-128465 Tursiops truncatus 68.80 0.00e+00 785.00
IUUC-Uma-129645 Ustilago maydis 32.61 3.00e-85 309.00
IUUC-Vda-129989 Verticillium dahliae 30.26 2.00e-55 209.00
IUUC-Vpa-130529 Vicugna pacos 70.30 0.00e+00 803.00
IUUC-Vvi-131059 Vitis vinifera 39.74 2.00e-120 426.00
IUUC-Xtr-132002 Xenopus tropicalis 71.48 0.00e+00 829.00
IUUC-Xma-133930 Xiphophorus maculatus 91.37 0.00e+00 1023.00
IUUC-Yli-134505 Yarrowia lipolytica 32.26 1.00e-83 303.00
IUUC-Zma-135895 Zea mays 42.21 9.00e-127 447.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved