• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • RepTar
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • BioGRID
    • mUbiSiDa
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Cja-018963
Ensembl Protein ID ENSCJAP00000013102.2
UniProt Accession F6W3G3; F6W3G3_CALJA
Genbank Protein ID ENSCJAP00000013102
Protein Name Uncharacterized protein
Genbank Nucleotide ID ACFV01028993
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSCJAG00000007032.2 ENSCJAT00000013811.2 ENSCJAP00000013102.2
ENSCJAG00000007032.2 ENSCJAT00000013782.2 ENSCJAP00000013073.2
ENSCJAG00000007032.2 ENSCJAT00000013762.2 ENSCJAP00000013055.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 9.50e-67 224.2 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    Avses+lkk++skyk+++ltvre++n+i+ yk+lkp+++s+v+nDg+sreL++ltGtipvp+rg+tynipi+lwll+tYP++PP+++vk
   Q: 2 AVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVK 90
    89*************************************************************************************** PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 91 PTSSM-TIKTG-KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Callithrix jacchus
Protein Sequence
(Fasta)
MAVSESQLKK MVSKYKYRDL TVRETVNVIT LYKDLKPVLD SYVFNDGSSR ELMNLTGTIP 60
VPYRGNTYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Cja-018963|UBD,UBD_UEV|Callithrix jacchus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CCGTCATGGC GGTGTCGGAG AGCCAGCTCA AGAAGATGGT GTCCAAGGTA AGGCTGCGAC 60
GCGCCCACCG CTCCCTTCCG CGCCCTGCCC AGTCCCGGCC CAGCCAAGCA AGCCTCCCAG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Cja-018963|UBD,UBD_UEV|Callithrix jacchus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 26.49 5.00e-27 115.00
IUUC-Aml-002415 Ailuropoda melanoleuca 91.07 0.00e+00 693.00
IUUC-Atr-002875 Amborella trichopoda 29.89 2.00e-34 139.00
IUUC-Apl-003473 Anas platyrhynchos 84.44 0.00e+00 651.00
IUUC-Aca-004573 Anolis carolinensis 85.20 0.00e+00 638.00
IUUC-Aly-006164 Arabidopsis lyrata 44.12 6.00e-22 98.60
IUUC-Ath-006575 Arabidopsis thaliana 30.00 3.00e-32 132.00
IUUC-Ago-007755 Ashbya gossypii 25.89 3.00e-05 43.10
IUUC-Acl-008218 Aspergillus clavatus 38.76 2.00e-25 110.00
IUUC-Afl-008597 Aspergillus flavus 39.10 3.00e-25 110.00
IUUC-Afu-009017 Aspergillus fumigatus 37.98 3.00e-23 103.00
IUUC-Ani-009468 Aspergillus nidulans 38.64 5.00e-21 95.90
IUUC-Ang-009755 Aspergillus niger 36.51 2.00e-22 100.00
IUUC-Aor-010072 Aspergillus oryzae 37.59 2.00e-25 110.00
IUUC-Ate-010400 Aspergillus terreus 37.98 1.00e-24 108.00
IUUC-Ame-011620 Astyanax mexicanus 79.13 2.00e-177 614.00
IUUC-Bgr-012136 Blumeria graminis 35.71 6.00e-24 105.00
IUUC-Bta-012557 Bos taurus 90.82 0.00e+00 687.00
IUUC-Bci-013881 Botrytis cinerea 36.76 4.00e-26 112.00
IUUC-Bdi-014325 Brachypodium distachyon 31.03 2.00e-14 73.20
IUUC-Bol-015933 Brassica oleracea 42.24 9.00e-24 104.00
IUUC-Bra-017442 Brassica rapa 42.24 5.00e-24 105.00
IUUC-Cel-018697 Caenorhabditis elegans 48.84 4.00e-37 148.00
IUUC-Cfa-020472 Canis familiaris 90.82 0.00e+00 690.00
IUUC-Cpo-022001 Cavia porcellus 91.33 0.00e+00 697.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 29.35 6.00e-32 132.00
IUUC-Csa-023959 Chlorocebus sabaeus 92.07 0.00e+00 674.00
IUUC-Cho-024389 Choloepus hoffmanni 56.36 4.00e-38 152.00
IUUC-Cin-025688 Ciona intestinalis 44.27 4.00e-98 351.00
IUUC-Cne-026904 Cryptococcus neoformans 29.05 1.00e-14 75.10
IUUC-Cme-027280 Cyanidioschyzon merolae 39.09 1.00e-17 84.30
IUUC-Dre-027913 Danio rerio 79.64 6.00e-170 589.00
IUUC-Dno-029672 Dasypus novemcinctus 90.56 0.00e+00 701.00
IUUC-Dor-030175 Dipodomys ordii 83.58 9.00e-83 300.00
IUUC-Dse-031375 Dothistroma septosporum 32.85 4.00e-23 102.00
IUUC-Dme-031736 Drosophila melanogaster 48.09 1.00e-96 346.00
IUUC-Ete-032343 Echinops telfairi 85.71 0.00e+00 657.00
IUUC-Eca-033926 Equus caballus 91.30 0.00e+00 696.00
IUUC-Eeu-034940 Erinaceus europaeus 89.80 0.00e+00 702.00
IUUC-Fca-035491 Felis catus 90.31 0.00e+00 682.00
IUUC-Fal-037508 Ficedula albicollis 85.97 0.00e+00 643.00
IUUC-Fox-037937 Fusarium oxysporum 32.31 3.00e-21 96.30
IUUC-Fso-038091 Fusarium solani 36.03 6.00e-25 108.00
IUUC-Gmo-039427 Gadus morhua 76.47 2.00e-165 574.00
IUUC-Ggr-039724 Gaeumannomyces graminis 37.31 5.00e-25 109.00
IUUC-Gga-040998 Gallus gallus 85.46 0.00e+00 667.00
IUUC-Gac-041356 Gasterosteus aculeatus 78.21 7.00e-177 612.00
IUUC-Gma-043566 Glycine max 39.68 3.00e-25 109.00
IUUC-Ggo-044967 Gorilla gorilla 92.07 0.00e+00 674.00
IUUC-Hsa-046686 Homo sapiens 92.07 0.00e+00 674.00
IUUC-Hvu-047430 Hordeum vulgare 37.40 4.00e-21 95.90
IUUC-Itr-047929 Ictidomys tridecemlineatus 94.71 1.00e-100 358.00
IUUC-Kpa-049287 Komagataella pastoris 25.92 7.00e-28 118.00
IUUC-Lch-050597 Latimeria chalumnae 82.70 0.00e+00 655.00
IUUC-Lpe-051090 Leersia perrieri 38.02 2.00e-20 93.60
IUUC-Loc-052399 Lepisosteus oculatus 76.53 9.00e-171 592.00
IUUC-Lma-053249 Leptosphaeria maculans 29.82 1.00e-13 71.60
IUUC-Laf-053766 Loxodonta africana 91.33 0.00e+00 695.00
IUUC-Mcc-055641 Macaca mulatta 92.07 0.00e+00 674.00
IUUC-Meu-055919 Macropus eugenii 87.16 3.00e-160 557.00
IUUC-Mor-056970 Magnaporthe oryzae 38.46 5.00e-24 105.00
IUUC-Mpo-057345 Magnaporthe poae 36.92 1.00e-22 101.00
IUUC-Mtr-058436 Medicago truncatula 38.10 9.00e-26 111.00
IUUC-Mla-059037 Melampsora laricipopulina 34.93 2.00e-25 110.00
IUUC-Mga-059263 Meleagris gallopavo 84.68 0.00e+00 644.00
IUUC-Mvi-060463 Microbotryum violaceum 30.20 2.00e-17 84.00
IUUC-Mmr-060915 Microcebus murinus 90.56 0.00e+00 688.00
IUUC-Mdo-062449 Monodelphis domestica 88.52 0.00e+00 671.00
IUUC-Mmu-063151 Mus musculus 87.24 0.00e+00 663.00
IUUC-Mac-065581 Musa acuminata 36.43 7.00e-22 98.20
IUUC-Mpu-066621 Mustela putorius furo 91.07 0.00e+00 693.00
IUUC-Mlu-067336 Myotis lucifugus 90.56 0.00e+00 672.00
IUUC-Nfi-068530 Neosartorya fischeri 38.76 2.00e-23 103.00
IUUC-Ncr-068785 Neurospora crassa 36.03 1.00e-24 107.00
IUUC-Nle-069972 Nomascus leucogenys 92.07 0.00e+00 674.00
IUUC-Opr-071150 Ochotona princeps 95.65 2.00e-85 309.00
IUUC-Ont-071366 Oreochromis niloticus 77.44 2.00e-177 615.00
IUUC-Oan-073290 Ornithorhynchus anatinus 95.05 1.00e-96 345.00
IUUC-Ocu-074351 Oryctolagus cuniculus 91.58 0.00e+00 696.00
IUUC-Oba-075338 Oryza barthii 37.14 1.00e-11 63.50
IUUC-Obr-076135 Oryza brachyantha 37.19 3.00e-20 92.80
IUUC-Ogl-077182 Oryza glaberrima 36.28 3.00e-17 82.80
IUUC-Ogu-078281 Oryza glumaepatula 26.93 9.00e-21 94.40
IUUC-Oin-079068 Oryza indica 36.28 6.00e-17 82.00
IUUC-Olo-080460 Oryza longistaminata 35.80 9.00e-09 52.80
IUUC-Ome-081781 Oryza meridionalis 25.41 1.00e-18 87.40
IUUC-Oni-082517 Oryza nivara 26.06 3.00e-17 82.80
IUUC-Opu-084101 Oryza punctata 36.28 2.00e-17 83.20
IUUC-Oru-084556 Oryza rufipogon 36.84 3.00e-17 82.80
IUUC-Osa-086264 Oryza sativa 36.28 3.00e-17 82.80
IUUC-Ola-087252 Oryzias latipes 93.29 6.00e-69 252.00
IUUC-Olu-087610 Ostreococcus lucimarinus 26.86 4.00e-13 68.90
IUUC-Oga-088304 Otolemur garnettii 91.07 0.00e+00 688.00
IUUC-Oar-089734 Ovis aries 90.82 0.00e+00 687.00
IUUC-Ptr-091476 Pan troglodytes 92.07 0.00e+00 674.00
IUUC-Pan-092341 Papio anubis 92.07 0.00e+00 674.00
IUUC-Psi-093470 Pelodiscus sinensis 85.45 0.00e+00 638.00
IUUC-Pma-094143 Petromyzon marinus 64.48 4.00e-130 457.00
IUUC-Pno-095069 Phaeosphaeria nodorum 31.93 2.00e-14 73.90
IUUC-Ppa-095933 Physcomitrella patens 27.98 2.00e-37 149.00
IUUC-Pfo-096321 Poecilia formosa 74.15 4.00e-169 587.00
IUUC-Pab-098527 Pongo abelii 87.82 2.00e-171 595.00
IUUC-Pop-099323 Populus trichocarpa 28.21 3.00e-36 145.00
IUUC-Pca-101044 Procavia capensis 93.10 4.00e-94 338.00
IUUC-Ppe-101458 Prunus persica 41.67 4.00e-27 115.00
IUUC-Pva-103014 Pteropus vampyrus 80.61 3.00e-161 561.00
IUUC-Pgr-103615 Puccinia graminis 36.09 2.00e-20 94.00
IUUC-Ptt-103826 Puccinia triticina 40.20 3.00e-16 80.10
IUUC-Pte-104171 Pyrenophora teres 35.29 1.00e-21 97.80
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 2.00e-10 60.50
IUUC-Rno-105957 Rattus norvegicus 86.48 0.00e+00 656.00
IUUC-Sce-106262 Saccharomyces cerevisiae 27.34 2.00e-10 60.10
IUUC-Sha-107607 Sarcophilus harrisii 87.43 2.00e-168 584.00
IUUC-Spo-108175 Schizosaccharomyces pombe 30.56 1.60e-02 34.30
IUUC-Ssl-108672 Sclerotinia sclerotiorum 35.29 3.00e-25 110.00
IUUC-Smo-108973 Selaginella moellendorffii 39.47 7.00e-21 94.70
IUUC-Sly-111373 Solanum lycopersicum 36.51 1.00e-23 103.00
IUUC-Stu-112844 Solanum tuberosum 35.71 7.00e-23 101.00
IUUC-Sar-113653 Sorex araneus 78.41 3.00e-169 587.00
IUUC-Sbi-114390 Sorghum bicolor 35.54 3.00e-20 92.80
IUUC-Sre-115200 Sporisorium reilianum 38.26 5.00e-24 106.00
IUUC-Ssc-115888 Sus scrofa 86.40 2.00e-101 361.00
IUUC-Tgu-117506 Taeniopygia guttata 81.71 0.00e+00 660.00
IUUC-Tru-118063 Takifugu rubripes 77.66 3.00e-165 574.00
IUUC-Tsy-118851 Tarsius syrichta 74.21 2.00e-141 494.00
IUUC-Tni-120010 Tetraodon nigroviridis 76.84 4.00e-162 563.00
IUUC-Tca-121182 Theobroma cacao 38.89 3.00e-22 99.80
IUUC-Tre-122040 Trichoderma reesei 36.15 7.00e-22 98.60
IUUC-Tvi-122660 Trichoderma virens 39.71 7.00e-26 112.00
IUUC-Tae-124561 Triticum aestivum 26.49 5.00e-27 115.00
IUUC-Tur-126651 Triticum urartu 37.40 7.00e-21 94.40
IUUC-Tme-127184 Tuber melanosporum 47.32 1.00e-25 110.00
IUUC-Tbe-127894 Tupaia belangeri 81.59 1.00e-86 313.00
IUUC-Ttr-128264 Tursiops truncatus 88.52 0.00e+00 690.00
IUUC-Uma-129407 Ustilago maydis 36.91 2.00e-24 107.00
IUUC-Vda-130002 Verticillium dahliae 30.82 5.00e-16 79.30
IUUC-Vpa-130156 Vicugna pacos 96.25 6.00e-91 327.00
IUUC-Vvi-131479 Vitis vinifera 41.23 1.00e-23 103.00
IUUC-Xtr-132332 Xenopus tropicalis 81.68 1.00e-63 234.00
IUUC-Xma-133186 Xiphophorus maculatus 76.25 6.00e-170 589.00
IUUC-Yli-134500 Yarrowia lipolytica 33.55 1.00e-12 67.80
IUUC-Zma-135391 Zea mays 36.13 6.00e-20 91.70
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved