• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • RepTar
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • BioGRID
    • mUbiSiDa
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Mdo-062449
Ensembl Protein ID ENSMODP00000007950.1
UniProt Accession F7FD96; F7FD96_MONDO
Protein Name Uncharacterized protein
Gene Name TSG101
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMODG00000006410.2 ENSMODT00000008112.2 ENSMODP00000007950.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/UBC-like/UBD_UEV 1.20e-65 219.9 2 145
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/UBC-like/UBD_UEV

   S: 1    AvsesslkkvpskykdkrltvrellnliesykslkpktasfvlnDgesreLlrltGtipvpergitynipiilwlletYPekPPfvsvk 89
    A+ es+lkk+ skyk+++ltvre++ +i+ yk+lkp+++s+v+nDg+sreL++ltGtipvp+rg++ynipi+lwll+tYP++PP+++vk
   Q: 2 AMPESQLKKMLSKYKYRDLTVRETVSVITLYKDLKPVLDSYVFNDGNSRELMSLTGTIPVPYRGNIYNIPICLWLLDTYPYNPPICFVK 90
    66799************************************************************************************ PP
   S: 90 ekidmntikssnehvdpnGkialpvLhkWknpasnlvelvqelivllskeppklsrp 146
    ++++m tik++ +hvd+nGki+lp+Lh+Wk+p+s+l+ l+q++iv++++epp++srp
   Q: 91 PTSSM-TIKTG-KHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP 145
    *****.*****.*******************************************98 PP
   

Organism Monodelphis domestica
Protein Sequence
(Fasta)
MAMPESQLKK MLSKYKYRDL TVRETVSVIT LYKDLKPVLD SYVFNDGNSR ELMSLTGTIP 60
VPYRGNIYNI PICLWLLDTY PYNPPICFVK PTSSMTIKTG KHVDANGKIY LPYLHEWKHP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mdo-062449|UBD,UBD_UEV|Monodelphis domestica
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ACATTTTCCG CAACTAGTAG TTTACTTATT GTAATCCCAG GTGTACTCAG TCTAACAGTC 60
CTAATATGAA GAGAATTATC AGCCTACAGG GTTCATGGTG TTTCAGACTT AACCCAGTTA 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mdo-062449|UBD,UBD_UEV|Monodelphis domestica
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0175--Coiled coil
KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR017916--SB_dom
IPR016135--UBQ-conjugating_enzyme/RWD
IPR008883--UEV_N

PROSITE

PS51312--SB
PS51322--UEV

Pfam

PF05743--UEV
PF09454--Vps23_core

Gene Ontology

GO:0005829--C:cytosol
GO:0005769--C:early endosome
GO:0000813--C:ESCRT I complex
GO:0070062--C:extracellular exosome
GO:0005770--C:late endosome
GO:0005730--C:nucleolus
GO:0005886--C:plasma membrane
GO:0003714--F:transcription corepressor activity
GO:0046790--F:virion binding
GO:0007050--P:cell cycle arrest
GO:0006464--P:cellular protein modification process
GO:1990182--P:exosomal secretion
GO:0030216--P:keratinocyte differentiation
GO:0008285--P:negative regulation of cell proliferation
GO:0042059--P:negative regulation of epidermal growth factor receptor signaling pathway
GO:0045892--P:negative regulation of transcription, DNA-templated
GO:1903543--P:positive regulation of exosomal secretion
GO:2000397--P:positive regulation of ubiquitin-dependent endocytosis
GO:1903774--P:positive regulation of viral budding via host ESCRT complex
GO:1902188--P:positive regulation of viral release from host cell
GO:0015031--P:protein transport
GO:0001558--P:regulation of cell growth
GO:1903551--P:regulation of extracellular exosome assembly
GO:0043405--P:regulation of MAP kinase activity
GO:0043162--P:ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0046755--P:viral budding

KEGG mdo:100019704
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001072 Aegilops tauschii 27.62 3.00e-27 115.00
IUUC-Aml-002415 Ailuropoda melanoleuca 93.61 0.00e+00 711.00
IUUC-Atr-002875 Amborella trichopoda 31.34 2.00e-39 156.00
IUUC-Apl-003473 Anas platyrhynchos 87.76 0.00e+00 681.00
IUUC-Aca-004573 Anolis carolinensis 89.29 0.00e+00 663.00
IUUC-Aly-006164 Arabidopsis lyrata 42.16 2.00e-20 93.20
IUUC-Ath-006575 Arabidopsis thaliana 28.61 3.00e-29 122.00
IUUC-Ago-007755 Ashbya gossypii 25.00 6.00e-07 48.90
IUUC-Acl-008218 Aspergillus clavatus 37.98 2.00e-24 107.00
IUUC-Afl-008597 Aspergillus flavus 39.85 6.00e-26 112.00
IUUC-Afu-009017 Aspergillus fumigatus 37.21 1.00e-22 101.00
IUUC-Ani-009468 Aspergillus nidulans 37.88 2.00e-20 94.40
IUUC-Ang-009755 Aspergillus niger 35.71 7.00e-22 99.00
IUUC-Aor-010072 Aspergillus oryzae 38.35 6.00e-26 112.00
IUUC-Ate-010400 Aspergillus terreus 37.98 2.00e-24 107.00
IUUC-Ame-011620 Astyanax mexicanus 80.10 0.00e+00 634.00
IUUC-Bgr-012136 Blumeria graminis 34.31 3.00e-22 99.80
IUUC-Bta-012557 Bos taurus 94.12 0.00e+00 729.00
IUUC-Bci-013881 Botrytis cinerea 36.69 7.00e-25 108.00
IUUC-Bdi-014325 Brachypodium distachyon 34.91 2.00e-13 69.70
IUUC-Bol-015933 Brassica oleracea 42.37 2.00e-23 103.00
IUUC-Bra-017605 Brassica rapa 39.52 4.00e-25 108.00
IUUC-Cel-018697 Caenorhabditis elegans 45.83 3.00e-37 149.00
IUUC-Cja-018963 Callithrix jacchus 88.32 0.00e+00 698.00
IUUC-Cfa-020472 Canis familiaris 94.12 0.00e+00 712.00
IUUC-Cpo-022001 Cavia porcellus 94.88 0.00e+00 717.00
IUUC-Cre-022918 Chlamydomonas reinhardtii 28.61 1.00e-31 130.00
IUUC-Csa-023959 Chlorocebus sabaeus 94.12 0.00e+00 685.00
IUUC-Cho-024389 Choloepus hoffmanni 53.64 5.00e-36 145.00
IUUC-Cin-025688 Ciona intestinalis 45.04 2.00e-99 355.00
IUUC-Cne-026904 Cryptococcus neoformans 31.02 4.00e-17 83.20
IUUC-Cme-027280 Cyanidioschyzon merolae 39.09 2.00e-17 83.20
IUUC-Dre-027913 Danio rerio 80.36 5.00e-174 603.00
IUUC-Dno-029672 Dasypus novemcinctus 93.86 0.00e+00 717.00
IUUC-Dor-030175 Dipodomys ordii 92.00 3.00e-91 328.00
IUUC-Dse-031375 Dothistroma septosporum 28.89 9.00e-23 101.00
IUUC-Dme-031736 Drosophila melanogaster 47.26 3.00e-97 348.00
IUUC-Ete-032343 Echinops telfairi 89.77 0.00e+00 680.00
IUUC-Eca-033926 Equus caballus 94.37 0.00e+00 710.00
IUUC-Eeu-034940 Erinaceus europaeus 86.96 0.00e+00 694.00
IUUC-Fca-035491 Felis catus 93.35 0.00e+00 699.00
IUUC-Fal-037508 Ficedula albicollis 89.29 0.00e+00 675.00
IUUC-Fox-037937 Fusarium oxysporum 31.54 8.00e-20 91.70
IUUC-Fso-038091 Fusarium solani 35.29 1.00e-23 103.00
IUUC-Gmo-039427 Gadus morhua 77.52 3.00e-169 587.00
IUUC-Ggr-039724 Gaeumannomyces graminis 36.57 2.00e-23 104.00
IUUC-Gga-040998 Gallus gallus 89.54 0.00e+00 711.00
IUUC-Gac-041356 Gasterosteus aculeatus 79.54 0.00e+00 634.00
IUUC-Gma-043566 Glycine max 38.89 1.00e-24 107.00
IUUC-Ggo-044967 Gorilla gorilla 94.12 0.00e+00 685.00
IUUC-Hsa-046686 Homo sapiens 94.12 0.00e+00 685.00
IUUC-Hvu-047430 Hordeum vulgare 27.30 3.00e-27 116.00
IUUC-Itr-047929 Ictidomys tridecemlineatus 93.30 5.00e-108 383.00
IUUC-Kpa-049287 Komagataella pastoris 25.00 1.00e-28 120.00
IUUC-Lch-050597 Latimeria chalumnae 85.71 0.00e+00 697.00
IUUC-Lpe-051090 Leersia perrieri 38.02 7.00e-20 91.70
IUUC-Loc-052399 Lepisosteus oculatus 83.29 5.00e-176 610.00
IUUC-Lma-053249 Leptosphaeria maculans 28.95 7.00e-13 68.90
IUUC-Laf-053766 Loxodonta africana 94.63 0.00e+00 714.00
IUUC-Mcc-055641 Macaca mulatta 94.12 0.00e+00 685.00
IUUC-Meu-055919 Macropus eugenii 93.56 2.00e-173 600.00
IUUC-Mor-056970 Magnaporthe oryzae 37.69 1.00e-22 101.00
IUUC-Mpo-057345 Magnaporthe poae 36.15 2.00e-21 97.10
IUUC-Mtr-058436 Medicago truncatula 29.79 3.00e-34 139.00
IUUC-Mla-059037 Melampsora laricipopulina 37.24 4.00e-26 112.00
IUUC-Mga-059263 Meleagris gallopavo 89.35 0.00e+00 692.00
IUUC-Mvi-060463 Microbotryum violaceum 29.94 2.00e-17 84.30
IUUC-Mmr-060915 Microcebus murinus 94.12 0.00e+00 710.00
IUUC-Mmu-063151 Mus musculus 91.30 0.00e+00 693.00
IUUC-Mac-065020 Musa acuminata 36.29 1.00e-22 100.00
IUUC-Mpu-066621 Mustela putorius furo 93.61 0.00e+00 711.00
IUUC-Mlu-067336 Myotis lucifugus 94.12 0.00e+00 696.00
IUUC-Nfi-068530 Neosartorya fischeri 37.98 1.00e-22 101.00
IUUC-Ncr-068785 Neurospora crassa 35.29 5.00e-23 102.00
IUUC-Nle-069972 Nomascus leucogenys 94.12 0.00e+00 685.00
IUUC-Opr-071150 Ochotona princeps 84.11 7.00e-86 310.00
IUUC-Ont-071366 Oreochromis niloticus 78.55 0.00e+00 630.00
IUUC-Oan-073290 Ornithorhynchus anatinus 92.17 2.00e-103 368.00
IUUC-Ocu-074351 Oryctolagus cuniculus 94.12 0.00e+00 712.00
IUUC-Oba-075338 Oryza barthii 26.29 2.00e-11 62.80
IUUC-Obr-076135 Oryza brachyantha 26.83 2.00e-28 119.00
IUUC-Ogl-077182 Oryza glaberrima 36.28 1.00e-16 80.90
IUUC-Ogu-078281 Oryza glumaepatula 26.30 2.00e-20 93.20
IUUC-Oin-079068 Oryza indica 36.28 3.00e-16 79.70
IUUC-Olo-080460 Oryza longistaminata 28.26 2.00e-08 51.60
IUUC-Ome-081781 Oryza meridionalis 24.86 1.00e-17 84.30
IUUC-Oni-082517 Oryza nivara 25.55 7.00e-21 95.10
IUUC-Opu-084101 Oryza punctata 36.28 9.00e-17 81.30
IUUC-Oru-084556 Oryza rufipogon 36.84 1.00e-16 80.50
IUUC-Osa-086264 Oryza sativa 36.28 1.00e-16 80.90
IUUC-Ola-087252 Oryzias latipes 91.28 6.00e-68 249.00
IUUC-Olu-087610 Ostreococcus lucimarinus 27.17 5.00e-16 79.00
IUUC-Oga-088304 Otolemur garnettii 94.37 0.00e+00 710.00
IUUC-Oar-089734 Ovis aries 94.12 0.00e+00 729.00
IUUC-Ptr-091476 Pan troglodytes 94.12 0.00e+00 685.00
IUUC-Pan-092341 Papio anubis 94.12 0.00e+00 685.00
IUUC-Psi-093470 Pelodiscus sinensis 91.69 0.00e+00 664.00
IUUC-Pma-094143 Petromyzon marinus 64.09 7.00e-132 463.00
IUUC-Pno-095069 Phaeosphaeria nodorum 33.02 3.00e-13 70.10
IUUC-Ppa-095933 Physcomitrella patens 30.81 9.00e-39 154.00
IUUC-Pfo-096321 Poecilia formosa 81.70 3.00e-173 600.00
IUUC-Pab-098527 Pongo abelii 93.48 5.00e-175 606.00
IUUC-Pop-099323 Populus trichocarpa 27.65 4.00e-36 145.00
IUUC-Pca-101044 Procavia capensis 77.24 2.00e-155 541.00
IUUC-Ppe-101458 Prunus persica 41.67 2.00e-26 113.00
IUUC-Pva-103014 Pteropus vampyrus 85.17 2.00e-170 592.00
IUUC-Pgr-103615 Puccinia graminis 38.35 8.00e-21 95.10
IUUC-Ptt-103826 Puccinia triticina 41.18 1.00e-16 81.30
IUUC-Pte-104171 Pyrenophora teres 34.90 8.00e-21 95.10
IUUC-Pyt-104433 Pyrenophora triticirepentis 33.01 2.00e-10 60.50
IUUC-Rno-105957 Rattus norvegicus 90.28 0.00e+00 686.00
IUUC-Sce-106262 Saccharomyces cerevisiae 29.53 8.00e-11 61.20
IUUC-Sha-107607 Sarcophilus harrisii 98.85 3.00e-177 613.00
IUUC-Spo-108175 Schizosaccharomyces pombe 29.63 2.40e-02 33.50
IUUC-Ssl-108672 Sclerotinia sclerotiorum 36.03 4.00e-25 109.00
IUUC-Smo-108973 Selaginella moellendorffii 38.60 9.00e-20 90.90
IUUC-Sly-111373 Solanum lycopersicum 36.51 4.00e-23 102.00
IUUC-Stu-112844 Solanum tuberosum 36.51 1.00e-22 100.00
IUUC-Sar-113653 Sorex araneus 78.66 2.00e-170 592.00
IUUC-Sbi-114390 Sorghum bicolor 27.17 5.00e-29 122.00
IUUC-Sre-115200 Sporisorium reilianum 37.67 2.00e-23 103.00
IUUC-Ssc-115888 Sus scrofa 94.27 2.00e-110 391.00
IUUC-Tgu-117506 Taeniopygia guttata 88.07 0.00e+00 685.00
IUUC-Tru-118063 Takifugu rubripes 78.15 8.00e-170 589.00
IUUC-Tsy-118851 Tarsius syrichta 72.41 3.00e-140 491.00
IUUC-Tni-120010 Tetraodon nigroviridis 77.41 2.00e-167 581.00
IUUC-Tca-121182 Theobroma cacao 38.89 1.00e-21 97.10
IUUC-Tre-122040 Trichoderma reesei 35.38 2.00e-20 94.00
IUUC-Tvi-122660 Trichoderma virens 38.97 3.00e-24 106.00
IUUC-Tae-124561 Triticum aestivum 27.62 3.00e-27 115.00
IUUC-Tur-126651 Triticum urartu 37.19 5.00e-20 91.70
IUUC-Tme-127184 Tuber melanosporum 46.43 8.00e-25 108.00
IUUC-Tbe-127894 Tupaia belangeri 79.00 2.00e-86 312.00
IUUC-Ttr-128264 Tursiops truncatus 86.45 0.00e+00 687.00
IUUC-Uma-129407 Ustilago maydis 38.57 1.00e-24 108.00
IUUC-Vda-130002 Verticillium dahliae 35.64 8.00e-15 75.10
IUUC-Vpa-130156 Vicugna pacos 92.00 2.00e-93 335.00
IUUC-Vvi-131479 Vitis vinifera 40.35 1.00e-22 100.00
IUUC-Xtr-132332 Xenopus tropicalis 80.15 4.00e-62 229.00
IUUC-Xma-133186 Xiphophorus maculatus 81.96 6.00e-177 613.00
IUUC-Yli-134500 Yarrowia lipolytica 32.90 2.00e-12 66.60
IUUC-Zma-135391 Zea mays 36.13 2.00e-19 90.10
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved