• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • AREsite
    • miRTarBase
    • microRNA
    • TRANSFAC
    • RepTar
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • PTM
    • CPLM
    • PhosphositePlus
    • mUbiSiDa
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
UUCD2 ID IUUC-Cel-018162
UUCD1 version UUC-CaE-00687
Ensembl Protein ID F58A4.10
UniProt Accession P34477; UBC7_CAEEL
Genbank Protein ID CAA80166.1
Protein Name Probable ubiquitin-conjugating enzyme E2 7; E2 ubiquitin-conjugating enzyme 7; Ubiquitin carrier protein 7; Ubiquitin-protein ligase 7
Genbank Nucleotide ID Z22179
Gene Name ubc-7; F58A4.10
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
WBGene00006704 F58A4.10 F58A4.10
Annotation
mRNA Expression
GEO
DNA & RNA Element
microRNARAID2
Protein 3D Structure
PDBMMDB
Protein Expression/Proteomics
GPMDB
Status Unreviewed
Classification
Family E-Value Score Start End
E2/UBC 1.90e-49 167.3 8 155
Active Site
Position(s) Description Evidence
88 Glycyl thioester intermediate {ECO:0000255|PROSITE-ProRule:PRU00388,
ECO:0000255|PROSITE-ProRule:PRU10133}
Domain Profile

   E2/UBC

   S: 2    lkkelkelekdppegisakpvdesdltewevlilGpedtpYeggvFkleiefpedYPfkPPkvkfltkifhPnvyenGkvClsilk...........eeek 91
    lkk+l+++++ p++g+sa++vd++d+++wevl++Gp+dt Yegg+Fk+ ++fp+dYP kPPk+kf+++i+hPn++++G+vC+sil+ +ee+
   Q: 8 LKKQLADMRRVPVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKPPKMKFISEIWHPNIDKEGNVCISILHdpgddkwgyerPEER 108
    6899*********************************************************************************8889999999999*** PP
   S: 92 Wspalsvesvllsiqsllaepnpesplneeaaellkknreeykkkvr 138
    W p+++ve++lls++s+l++pn+esp+n++aa++ ++n +e+kkkv
   Q: 109 WLPVHTVETILLSVISMLTDPNFESPANVDAAKMQRENYAEFKKKVA 155
    *********************************************96 PP
   

Organism Caenorhabditis elegans
Functional Description
(View)

Functional Description



     Catalyzes the covalent attachment of ubiquitin to other proteins.
Catalyzes the covalent attachment of ubiquitin to other proteins.
Protein Sequence
(Fasta)
MEQSSLLLKK QLADMRRVPV DGFSAGLVDD NDIYKWEVLV IGPPDTLYEG GFFKAILDFP 60
RDYPQKPPKM KFISEIWHPN IDKEGNVCIS ILHDPGDDKW GYERPEERWL PVHTVETILL 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Cel-018162|E2,E2/UBC|Caenorhabditis elegans
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATAGATGGAG CAATCCTCCC TACTTCTGAA GAAACAGCTG GCAGGTGAGT TGGGATTAAA 60
CGTGATCTAT GATCAAAACT AACTTTTTTC TGTTTCCAGA CATGCGCAGA GTTCCAGTCG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Cel-018162|E2,E2/UBC|Caenorhabditis elegans
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0002--3D-structure
KW-0067--ATP-binding
KW-0181--Complete proteome
KW-0547--Nucleotide-binding
KW-1185--Reference proteome
KW-0808--Transferase
KW-0833--Ubl conjugation pathway

Interpro

IPR000608--UBQ-conjugat_E2
IPR023313--UBQ-conjugating_AS
IPR016135--UBQ-conjugating_enzyme/RWD

PROSITE

PS00183--UBIQUITIN_CONJUGAT_1
PS50127--UBIQUITIN_CONJUGAT_2

Pfam

PF00179--UQ_con

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005524--F:ATP binding
GO:0061630--F:ubiquitin protein ligase activity
GO:0031625--F:ubiquitin protein ligase binding
GO:0000209--P:protein polyubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG cel:CELE_F58A4.10
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000411 Aegilops tauschii 46.33 6.00e-42 162.00
IUUC-Aml-001379 Ailuropoda melanoleuca 72.67 2.00e-70 256.00
IUUC-Atr-002446 Amborella trichopoda 64.60 4.00e-46 175.00
IUUC-Apl-003579 Anas platyrhynchos 72.05 4.00e-70 255.00
IUUC-Aca-005146 Anolis carolinensis 73.68 1.00e-67 246.00
IUUC-Aly-005452 Arabidopsis lyrata 66.00 9.00e-53 197.00
IUUC-Ath-007644 Arabidopsis thaliana 67.59 7.00e-52 194.00
IUUC-Acl-008329 Aspergillus clavatus 57.50 3.00e-46 176.00
IUUC-Afl-008660 Aspergillus flavus 56.88 6.00e-47 178.00
IUUC-Afu-008841 Aspergillus fumigatus 59.59 5.00e-45 172.00
IUUC-Ang-009536 Aspergillus niger 57.50 4.00e-46 175.00
IUUC-Aor-009951 Aspergillus oryzae 57.32 6.00e-47 178.00
IUUC-Ate-010276 Aspergillus terreus 57.50 2.00e-46 176.00
IUUC-Ame-010634 Astyanax mexicanus 71.03 9.00e-63 234.00
IUUC-Bta-013324 Bos taurus 76.71 4.00e-67 245.00
IUUC-Bdi-014838 Brachypodium distachyon 62.73 1.00e-54 204.00
IUUC-Bol-016383 Brassica oleracea 69.66 9.00e-61 224.00
IUUC-Bra-017324 Brassica rapa 67.59 1.00e-52 197.00
IUUC-Cja-018734 Callithrix jacchus 69.94 3.00e-68 249.00
IUUC-Cfa-020846 Canis familiaris 71.60 8.00e-70 254.00
IUUC-Cpo-022207 Cavia porcellus 73.86 4.00e-68 248.00
IUUC-Cre-022895 Chlamydomonas reinhardtii 66.25 5.00e-58 215.00
IUUC-Csa-024193 Chlorocebus sabaeus 76.71 4.00e-67 245.00
IUUC-Cho-024621 Choloepus hoffmanni 79.03 1.00e-26 111.00
IUUC-Cin-025131 Ciona intestinalis 68.32 9.00e-67 244.00
IUUC-Csv-026074 Ciona savignyi 71.71 3.00e-65 239.00
IUUC-Cne-026796 Cryptococcus neoformans 58.79 1.00e-48 184.00
IUUC-Cme-027321 Cyanidioschyzon merolae 57.67 7.00e-47 178.00
IUUC-Dre-028653 Danio rerio 74.07 4.00e-73 265.00
IUUC-Dno-029479 Dasypus novemcinctus 76.71 4.00e-67 245.00
IUUC-Dse-031230 Dothistroma septosporum 53.46 8.00e-45 171.00
IUUC-Dme-031951 Drosophila melanogaster 79.63 3.00e-77 279.00
IUUC-Ete-032885 Echinops telfairi 76.71 4.00e-67 245.00
IUUC-Eca-034057 Equus caballus 73.68 1.00e-67 246.00
IUUC-Eeu-035128 Erinaceus europaeus 57.33 3.00e-45 172.00
IUUC-Fca-035835 Felis catus 73.68 1.00e-67 246.00
IUUC-Fal-036778 Ficedula albicollis 76.71 4.00e-67 245.00
IUUC-Gmo-039504 Gadus morhua 73.01 1.00e-70 257.00
IUUC-Gga-040950 Gallus gallus 76.71 4.00e-67 245.00
IUUC-Gac-042210 Gasterosteus aculeatus 74.23 1.00e-71 260.00
IUUC-Gma-044131 Glycine max 65.33 2.00e-45 172.00
IUUC-Ggo-044826 Gorilla gorilla 76.71 4.00e-67 245.00
IUUC-Hsa-046638 Homo sapiens 76.71 4.00e-67 245.00
IUUC-Hvu-047065 Hordeum vulgare 62.00 5.00e-50 189.00
IUUC-Itr-048581 Ictidomys tridecemlineatus 75.00 4.00e-50 188.00
IUUC-Lch-050446 Latimeria chalumnae 74.07 1.00e-72 264.00
IUUC-Lpe-050981 Leersia perrieri 63.45 2.00e-49 187.00
IUUC-Loc-052277 Lepisosteus oculatus 76.71 4.00e-67 245.00
IUUC-Lma-053320 Leptosphaeria maculans 56.60 1.00e-45 174.00
IUUC-Laf-053491 Loxodonta africana 76.71 4.00e-67 245.00
IUUC-Mcc-055624 Macaca mulatta 74.67 2.00e-67 246.00
IUUC-Meu-056870 Macropus eugenii 74.00 2.00e-62 229.00
IUUC-Mtr-058406 Medicago truncatula 68.67 6.00e-55 204.00
IUUC-Mla-059165 Melampsora laricipopulina 58.28 4.00e-57 212.00
IUUC-Mga-060005 Meleagris gallopavo 74.17 2.00e-67 246.00
IUUC-Mvi-060318 Microbotryum violaceum 61.49 8.00e-49 184.00
IUUC-Mmr-061442 Microcebus murinus 76.71 4.00e-67 245.00
IUUC-Mdo-062364 Monodelphis domestica 72.84 1.00e-71 260.00
IUUC-Mmu-064163 Mus musculus 76.71 4.00e-67 245.00
IUUC-Mac-065294 Musa acuminata 64.00 2.00e-51 193.00
IUUC-Mpu-066561 Mustela putorius furo 71.60 3.00e-69 252.00
IUUC-Mlu-067331 Myotis lucifugus 76.71 4.00e-67 245.00
IUUC-Nfi-068431 Neosartorya fischeri 60.27 3.00e-45 172.00
IUUC-Opr-070958 Ochotona princeps 74.67 2.00e-67 246.00
IUUC-Ont-072627 Oreochromis niloticus 75.31 5.00e-72 261.00
IUUC-Ocu-074321 Oryctolagus cuniculus 70.30 5.00e-68 248.00
IUUC-Oba-075915 Oryza barthii 64.14 1.00e-55 207.00
IUUC-Obr-076863 Oryza brachyantha 64.14 2.00e-50 190.00
IUUC-Ogl-076981 Oryza glaberrima 64.14 1.00e-55 207.00
IUUC-Ogu-078183 Oryza glumaepatula 64.14 1.00e-55 207.00
IUUC-Oin-079755 Oryza indica 64.14 1.00e-55 207.00
IUUC-Olo-080576 Oryza longistaminata 64.14 1.00e-55 207.00
IUUC-Ome-081190 Oryza meridionalis 60.39 2.00e-53 199.00
IUUC-Oni-083010 Oryza nivara 64.14 1.00e-55 207.00
IUUC-Opu-083784 Oryza punctata 63.45 5.00e-49 185.00
IUUC-Oru-084817 Oryza rufipogon 64.14 1.00e-55 207.00
IUUC-Osa-085291 Oryza sativa 64.14 1.00e-55 207.00
IUUC-Ola-087228 Oryzias latipes 74.23 9.00e-72 260.00
IUUC-Olu-087887 Ostreococcus lucimarinus 65.64 3.00e-64 235.00
IUUC-Oga-088473 Otolemur garnettii 72.05 2.00e-70 256.00
IUUC-Oar-090047 Ovis aries 74.17 2.00e-67 246.00
IUUC-Ptr-091331 Pan troglodytes 74.67 2.00e-67 246.00
IUUC-Pan-092230 Papio anubis 76.71 4.00e-67 245.00
IUUC-Psi-093996 Pelodiscus sinensis 74.17 2.00e-67 246.00
IUUC-Ppa-095611 Physcomitrella patens 65.84 4.00e-62 228.00
IUUC-Pfo-096425 Poecilia formosa 74.23 5.00e-72 262.00
IUUC-Pab-098727 Pongo abelii 76.71 4.00e-67 245.00
IUUC-Pop-099940 Populus trichocarpa 66.00 2.00e-53 200.00
IUUC-Pca-100369 Procavia capensis 76.03 2.00e-65 240.00
IUUC-Ppe-101778 Prunus persica 65.33 6.00e-52 194.00
IUUC-Pva-103074 Pteropus vampyrus 76.71 2.00e-67 247.00
IUUC-Pgr-103274 Puccinia graminis 57.60 6.00e-46 174.00
IUUC-Pyt-104551 Pyrenophora triticirepentis 57.23 6.00e-46 175.00
IUUC-Rno-104929 Rattus norvegicus 76.71 4.00e-67 245.00
IUUC-Sha-106753 Sarcophilus harrisii 72.84 1.00e-71 260.00
IUUC-Sja-107917 Schizosaccharomyces japonicus 68.91 7.00e-48 181.00
IUUC-Spo-108104 Schizosaccharomyces pombe 66.88 6.00e-61 224.00
IUUC-Smo-109401 Selaginella moellendorffii 65.03 2.00e-51 193.00
IUUC-Sit-110012 Setaria italica 57.06 6.00e-52 195.00
IUUC-Sly-111843 Solanum lycopersicum 63.98 3.00e-56 209.00
IUUC-Stu-112654 Solanum tuberosum 67.59 9.00e-53 197.00
IUUC-Sbi-113787 Sorghum bicolor 62.73 5.00e-55 205.00
IUUC-Sre-114933 Sporisorium reilianum 62.58 1.00e-53 200.00
IUUC-Ssc-115912 Sus scrofa 71.43 2.00e-68 249.00
IUUC-Tgu-116635 Taeniopygia guttata 74.17 2.00e-67 246.00
IUUC-Tru-118534 Takifugu rubripes 73.62 2.00e-71 259.00
IUUC-Tsy-119168 Tarsius syrichta 76.71 2.00e-67 247.00
IUUC-Tni-119748 Tetraodon nigroviridis 73.01 7.00e-71 258.00
IUUC-Tca-121649 Theobroma cacao 66.21 2.00e-51 192.00
IUUC-Tae-123772 Triticum aestivum 63.98 6.00e-56 208.00
IUUC-Tur-126873 Triticum urartu 63.82 8.00e-53 199.00
IUUC-Tme-126974 Tuber melanosporum 57.41 1.00e-40 157.00
IUUC-Tbe-127917 Tupaia belangeri 74.67 2.00e-67 246.00
IUUC-Ttr-128609 Tursiops truncatus 76.71 6.00e-67 245.00
IUUC-Uma-129506 Ustilago maydis 63.19 3.00e-54 202.00
IUUC-Vpa-130208 Vicugna pacos 74.67 1.00e-67 248.00
IUUC-Vvi-131387 Vitis vinifera 66.00 7.00e-52 194.00
IUUC-Xtr-131942 Xenopus tropicalis 77.40 1.00e-67 246.00
IUUC-Xma-134052 Xiphophorus maculatus 74.23 1.00e-71 261.00
IUUC-Zma-135764 Zea mays 62.00 4.00e-50 189.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved