• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • RepTar
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • PTM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • UniProt
    • PHOSIDA
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
iUUCD ID IUUC-Hsa-046558
UUCD1 version UUC-HoS-00439
Ensembl Protein ID ENSP00000281623.3
UniProt Accession Q9UKT5; Q68CU8; Q86VT8; Q9UK98; FBX4_HUMAN
Genbank Protein ID AAF03703.1; AAH48098.1; CAH18486.1; AAF04468.1
Protein Name F-box only protein 4
Genbank Nucleotide ID AF176703; BC048098; CR749719; AF129534
Gene Name FBXO4; FBX4
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSG00000151876.12 ENST00000513496.5 ENSP00000424750.1
ENSG00000151876.12 ENST00000296812.6 ENSP00000296812.2
ENSG00000151876.12 ENST00000281623.7 ENSP00000281623.3
ENSG00000151876.12 ENST00000504463.5 ENSP00000424991.1
ENSG00000151876.12 ENST00000509134.1 ENSP00000421749.1
Annotation
Cancer Mutation
TCGAICGCCOSMICCGAP
IntOGen
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEOArrayExpressTCGAICGC
COSMICHPM
DNA & RNA Element
UTRdbAREsitecircBasecircRNADb
CircNetmiRTarBasemicroRNATRANSFAC
miRWalkTargetScanRepTarmiRNAMap
SomamiRmiRcodeRAID2
Protein-protein Interaction
IIDiRefIndexHINTMentha
InWeb_IM
Protein 3D Structure
PDBMMDB
Disease-associated Information
OMIM
Post-translational Modifications (PTMs)
CPLMdbPAFPhosSNPPhosphositePlus
dbPTMHPRDPhospho.ELMUniProt
DNA Methylation
TCGAICGCCOSMIC
Protein Expression/Proteomics
THPAHPMGPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
E3 adaptor/Cullin RING/SCF/F-box F-box 20181953; 19683498; 19343786; 19221502; 15520277
Classification
Family E-value Score Start End
E3 adaptor/Cullin RING/SCF/F-box 0.02 16.6 46 101
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/F-box

   S: 91   tptpee.gpdaglldrlpeeilveilklldkeellraarvcrrwqelasqkalwkt 145
    t + ee + a++l+rlp ++++ il++l++++l+++ ++ + w+e+ +++ lw+
   Q: 46 TTSREEvDEAASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRY 101
    444444145678899******************************99999999985 PP
   

Organism Homo sapiens
Functional Description
(View)

Functional Description



     Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes ubiquitination of CCND1 and its subsequent proteasomal degradation. Recognizes TERF1 and promotes its ubiquitination together with UBE2D1.
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex that mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes ubiquitination of CCND1 and its subsequent proteasomal degradation. Recognizes TERF1 and promotes its ubiquitination together with UBE2D1.
Protein Sequence
(Fasta)
MAGSEPRSGT NSPPPPFSDW GRLEAAILSG WKTFWQSVSK ERVARTTSRE EVDEAASTLT 60
RLPIDVQLYI LSFLSPHDLC QLGSTNHYWN ETVRDPILWR YFLLRDLPSW SSVDWKSLPD 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Hsa-046558|E3,F-box|Homo sapiens
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGAGGCTGAC GCGCTAGCGT GGCTCTAAGA CGCGTCACCC ACGCTGCGGG CAAGCCATGG 60
CGGGAAGCGA GCCGCGCAGC GGAACAAACT CGCCGCCGCC GCCCTTCAGC GACTGGGGCC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Hsa-046558|E3,F-box|Homo sapiens
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0002--3D-structure
KW-0025--Alternative splicing
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0597--Phosphoprotein
KW-0621--Polymorphism
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR001810--F-box_dom

PROSITE

PS50181--FBOX

Pfam

PF00646--F-box

SMART

SM00256--FBOX

Gene Ontology

GO:0005737--C:cytoplasm
GO:0005829--C:cytosol
GO:0019005--C:SCF ubiquitin ligase complex
GO:0000151--C:ubiquitin ligase complex
GO:0042803--F:protein homodimerization activity
GO:0061630--F:ubiquitin protein ligase activity
GO:0004842--F:ubiquitin-protein transferase activity
GO:0007568--P:aging
GO:0019725--P:cellular homeostasis
GO:0071479--P:cellular response to ionizing radiation
GO:0035726--P:common myeloid progenitor cell proliferation
GO:0048147--P:negative regulation of fibroblast proliferation
GO:1900181--P:negative regulation of protein localization to nucleus
GO:1902916--P:positive regulation of protein polyubiquitination
GO:0031398--P:positive regulation of protein ubiquitination
GO:0010608--P:posttranscriptional regulation of gene expression
GO:0031648--P:protein destabilization
GO:0000209--P:protein polyubiquitination
GO:0016567--P:protein ubiquitination
GO:2000001--P:regulation of DNA damage checkpoint
GO:0031146--P:SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0000723--P:telomere maintenance
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG hsa:26272
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Aml-001232 Ailuropoda melanoleuca 91.33 0.00e+00 685.00
IUUC-Apl-004129 Anas platyrhynchos 63.45 1.00e-111 395.00
IUUC-Aca-005076 Anolis carolinensis 50.00 3.00e-110 392.00
IUUC-Aly-006351 Arabidopsis lyrata 37.21 1.00e-03 37.40
IUUC-Ath-007114 Arabidopsis thaliana 33.85 3.00e-04 39.30
IUUC-Ame-011122 Astyanax mexicanus 47.04 2.00e-86 312.00
IUUC-Bta-012449 Bos taurus 90.44 0.00e+00 686.00
IUUC-Bol-015278 Brassica oleracea 23.17 1.00e-04 40.80
IUUC-Cja-019890 Callithrix jacchus 95.87 0.00e+00 757.00
IUUC-Cfa-021134 Canis familiaris 89.92 0.00e+00 689.00
IUUC-Cpo-021693 Cavia porcellus 90.43 4.00e-171 593.00
IUUC-Csa-023540 Chlorocebus sabaeus 98.71 0.00e+00 754.00
IUUC-Dre-028667 Danio rerio 47.27 5.00e-87 314.00
IUUC-Dno-028997 Dasypus novemcinctus 90.71 0.00e+00 674.00
IUUC-Dor-030135 Dipodomys ordii 80.00 3.00e-154 538.00
IUUC-Ete-033149 Echinops telfairi 85.09 0.00e+00 647.00
IUUC-Eca-033292 Equus caballus 92.90 1.00e-176 612.00
IUUC-Eeu-034504 Erinaceus europaeus 73.15 2.00e-128 451.00
IUUC-Fca-036476 Felis catus 91.73 0.00e+00 745.00
IUUC-Fal-036711 Ficedula albicollis 63.66 1.00e-120 425.00
IUUC-Gmo-039592 Gadus morhua 48.60 8.00e-86 310.00
IUUC-Gga-040924 Gallus gallus 64.00 5.00e-126 444.00
IUUC-Gac-041791 Gasterosteus aculeatus 50.15 1.00e-84 306.00
IUUC-Ggo-044736 Gorilla gorilla 99.22 0.00e+00 758.00
IUUC-Itr-048956 Ictidomys tridecemlineatus 90.96 0.00e+00 682.00
IUUC-Lch-049817 Latimeria chalumnae 66.46 1.00e-128 452.00
IUUC-Loc-052226 Lepisosteus oculatus 51.77 7.00e-108 384.00
IUUC-Laf-054371 Loxodonta africana 90.18 0.00e+00 693.00
IUUC-Mcc-054904 Macaca mulatta 98.45 0.00e+00 753.00
IUUC-Meu-056192 Macropus eugenii 56.79 9.00e-92 330.00
IUUC-Mmr-061692 Microcebus murinus 91.21 0.00e+00 717.00
IUUC-Mdo-062666 Monodelphis domestica 75.68 2.00e-158 551.00
IUUC-Mmu-064223 Mus musculus 88.11 0.00e+00 715.00
IUUC-Mpu-066290 Mustela putorius furo 91.99 0.00e+00 694.00
IUUC-Mlu-067882 Myotis lucifugus 89.41 0.00e+00 699.00
IUUC-Nle-070162 Nomascus leucogenys 98.45 0.00e+00 751.00
IUUC-Opr-070789 Ochotona princeps 85.62 2.00e-74 272.00
IUUC-Ont-071690 Oreochromis niloticus 44.70 1.00e-77 283.00
IUUC-Oan-072928 Ornithorhynchus anatinus 73.46 3.00e-114 404.00
IUUC-Ocu-073857 Oryctolagus cuniculus 90.51 0.00e+00 640.00
IUUC-Ogu-078061 Oryza glumaepatula 31.15 6.20e-01 31.20
IUUC-Oni-083091 Oryza nivara 31.15 6.10e-01 31.20
IUUC-Oru-085096 Oryza rufipogon 31.15 6.00e-01 30.80
IUUC-Osa-086253 Oryza sativa 33.33 2.40e-01 30.40
IUUC-Ola-086607 Oryzias latipes 46.99 7.00e-84 304.00
IUUC-Oga-088929 Otolemur garnettii 93.17 0.00e+00 669.00
IUUC-Oar-089305 Ovis aries 94.14 4.00e-179 620.00
IUUC-Ptr-090813 Pan troglodytes 94.32 0.00e+00 724.00
IUUC-Pan-092924 Papio anubis 96.68 0.00e+00 678.00
IUUC-Psi-093237 Pelodiscus sinensis 67.47 2.00e-132 465.00
IUUC-Pfo-096259 Poecilia formosa 47.25 5.00e-86 311.00
IUUC-Pab-098292 Pongo abelii 98.97 0.00e+00 755.00
IUUC-Pva-102221 Pteropus vampyrus 92.51 0.00e+00 724.00
IUUC-Rno-105910 Rattus norvegicus 88.63 0.00e+00 715.00
IUUC-Sha-106998 Sarcophilus harrisii 76.82 6.00e-162 563.00
IUUC-Sar-113033 Sorex araneus 78.55 2.00e-172 598.00
IUUC-Ssc-115507 Sus scrofa 89.66 0.00e+00 654.00
IUUC-Tgu-116502 Taeniopygia guttata 63.25 4.00e-117 414.00
IUUC-Tru-118203 Takifugu rubripes 44.57 4.00e-75 275.00
IUUC-Tni-120249 Tetraodon nigroviridis 48.18 5.00e-76 278.00
IUUC-Tur-126361 Triticum urartu 26.15 1.00e-03 37.00
IUUC-Tbe-128100 Tupaia belangeri 68.16 2.00e-121 428.00
IUUC-Ttr-128299 Tursiops truncatus 82.17 0.00e+00 629.00
IUUC-Vpa-130394 Vicugna pacos 79.59 7.00e-167 580.00
IUUC-Xtr-131825 Xenopus tropicalis 55.32 4.00e-122 431.00
IUUC-Xma-133942 Xiphophorus maculatus 47.17 8.00e-89 320.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved