• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • AREsite
    • miRTarBase
    • microRNA
    • TRANSFAC
    • RepTar
    • miRNAMap
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • PHOSIDA
    • mUbiSiDa
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Ogu-078497
Ensembl Protein ID OGLUM01G03340.1
UniProt Accession A0A0D9Y380; A0A0D9Y380_9ORYZ
Protein Name Uncharacterized protein
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
OGLUM01G03340 OGLUM01G03340.1 OGLUM01G03340.1
Status Unreviewed
Classification
Family E-Value Score Start End
E3 activity/N-recognin/UBR-box 1.80e-19 71.1 121 188
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 activity/N-recognin/UBR-box

   S: 2    lCgrvfkvgetiyeCrtCsvdetlvlCteCfakvvHkdHeyklkksggggfCdCGdteAwedgskCkkl 70
    Cg v+ +++ y+CrtC+ d+t+++C+ Cf++ HkdH+y++ +g gg+CdCGdt+Aw+ + +C +
   Q: 121 VCGSVWGQNDLAYRCRTCEHDPTCAICVPCFQNGNHKDHDYSIMYTG-GGCCDCGDTTAWKREGFCSRH 188
    6*****************************************97666.9*****************988 PP
   

Organism Oryza glumaepatula
Protein Sequence
(Fasta)
MAGMDGGGGP SDAPPELSTQ ELIEQKLILF GVPQEQLQEH QEGLLIYLEE HKELIPEIAK 60
LVLSVGADLL EARKALNKDG DSSNSEACDE ILSWLQWLMF NNEPHTMLDD LERSTAGERA 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ogu-078497|E3,UBR-box|Oryza glumaepatula
Please wait for a moment...
Nucleotide Sequence
(Fasta)
CATCTCCCCT CCTCCCCATT CGCGATTAGC CACACCACCA CGGCCGCCTC CCCTCCCAAA 60
ATAAAAAATT AAAAAAAAAA CGAGAGAAGA AGAAAAGCCG AATCATCGAG CCTCTTCCTC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ogu-078497|E3,UBR-box|Oryza glumaepatula
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR013083--Znf_RING/FYVE/PHD
IPR003126--Znf_UBR

PROSITE

PS51157--ZF_UBR

Pfam

PF02207--zf-UBR

SMART

SM00396--ZnF_UBR1

Gene Ontology

GO:0004842--F:ubiquitin-protein transferase activity
GO:0008270--F:zinc ion binding
GO:0050994--P:regulation of lipid catabolic process
GO:0010029--P:regulation of seed germination
GO:0009737--P:response to abscisic acid
GO:0006511--P:ubiquitin-dependent protein catabolic process

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000949 Aegilops tauschii 68.85 0.00e+00 2230.00
IUUC-Aml-002071 Ailuropoda melanoleuca 47.50 1.00e-18 88.20
IUUC-Atr-002501 Amborella trichopoda 43.21 0.00e+00 950.00
IUUC-Apl-003859 Anas platyrhynchos 47.50 8.00e-19 88.60
IUUC-Aca-004832 Anolis carolinensis 47.50 1.00e-18 88.60
IUUC-Aly-005901 Arabidopsis lyrata 39.65 0.00e+00 1119.00
IUUC-Ath-007148 Arabidopsis thaliana 39.57 0.00e+00 1130.00
IUUC-Ago-007752 Ashbya gossypii 40.00 7.00e-08 53.50
IUUC-Acl-008055 Aspergillus clavatus 22.75 3.00e-08 54.70
IUUC-Afl-008479 Aspergillus flavus 36.89 4.00e-09 57.80
IUUC-Afu-008929 Aspergillus fumigatus 30.34 3.00e-10 61.60
IUUC-Ani-009334 Aspergillus nidulans 31.50 1.00e-15 79.70
IUUC-Ang-009550 Aspergillus niger 22.78 4.00e-10 61.20
IUUC-Aor-010124 Aspergillus oryzae 36.89 4.00e-09 57.80
IUUC-Ate-010550 Aspergillus terreus 21.17 6.00e-09 57.40
IUUC-Ame-011231 Astyanax mexicanus 36.23 4.00e-13 70.90
IUUC-Bgr-011999 Blumeria graminis 37.80 7.00e-13 70.50
IUUC-Bta-012347 Bos taurus 37.50 2.00e-22 101.00
IUUC-Bci-013834 Botrytis cinerea 35.19 5.00e-14 74.30
IUUC-Bdi-014635 Brachypodium distachyon 74.88 0.00e+00 2882.00
IUUC-Bol-015669 Brassica oleracea 39.82 0.00e+00 1214.00
IUUC-Bra-017776 Brassica rapa 39.86 0.00e+00 1247.00
IUUC-Cel-018476 Caenorhabditis elegans 45.07 3.00e-11 64.70
IUUC-Cja-019761 Callithrix jacchus 47.50 1.00e-18 87.80
IUUC-Cfa-020950 Canis familiaris 37.00 4.00e-17 84.30
IUUC-Cpo-021462 Cavia porcellus 47.50 3.00e-17 83.20
IUUC-Csa-024255 Chlorocebus sabaeus 39.10 5.00e-23 103.00
IUUC-Cho-024550 Choloepus hoffmanni 43.00 2.00e-21 98.20
IUUC-Cin-025110 Ciona intestinalis 36.09 1.00e-20 95.50
IUUC-Csv-026296 Ciona savignyi 39.29 9.00e-10 57.40
IUUC-Cgl-026605 Colletotrichum gloeosporioides 35.34 5.00e-15 77.40
IUUC-Cne-026823 Cryptococcus neoformans 32.58 5.00e-11 63.90
IUUC-Dre-028343 Danio rerio 25.16 4.00e-25 110.00
IUUC-Dno-029345 Dasypus novemcinctus 47.50 1.00e-18 88.20
IUUC-Dor-031073 Dipodomys ordii 38.54 4.00e-14 74.30
IUUC-Dse-031531 Dothistroma septosporum 38.55 7.00e-15 77.00
IUUC-Dme-032215 Drosophila melanogaster 42.86 9.00e-20 93.20
IUUC-Ete-033162 Echinops telfairi 21.60 6.00e-14 73.60
IUUC-Eca-033454 Equus caballus 35.00 3.00e-16 81.30
IUUC-Eeu-034664 Erinaceus europaeus 44.00 6.00e-22 100.00
IUUC-Fca-036588 Felis catus 37.00 3.00e-17 84.30
IUUC-Fal-037333 Ficedula albicollis 44.44 3.00e-21 97.80
IUUC-Fox-037984 Fusarium oxysporum 33.33 2.00e-14 75.50
IUUC-Fso-038463 Fusarium solani 31.67 7.00e-14 73.60
IUUC-Gmo-038976 Gadus morhua 45.78 2.00e-16 80.50
IUUC-Ggr-040070 Gaeumannomyces graminis 35.71 8.00e-15 76.60
IUUC-Gga-041123 Gallus gallus 31.34 3.00e-17 84.70
IUUC-Gac-041985 Gasterosteus aculeatus 30.50 1.00e-09 58.90
IUUC-Gma-043622 Glycine max 42.10 0.00e+00 1405.00
IUUC-Ggo-045583 Gorilla gorilla 37.00 3.00e-17 84.70
IUUC-Hsa-046753 Homo sapiens 38.35 9.00e-22 99.80
IUUC-Hvu-047707 Hordeum vulgare 72.17 0.00e+00 1923.00
IUUC-Itr-048464 Ictidomys tridecemlineatus 47.50 3.00e-18 88.20
IUUC-Kpa-049088 Komagataella pastoris 32.65 3.00e-11 64.70
IUUC-Lch-050205 Latimeria chalumnae 35.71 6.00e-20 93.60
IUUC-Lpe-051516 Leersia perrieri 86.84 0.00e+00 3509.00
IUUC-Loc-052624 Lepisosteus oculatus 41.49 2.00e-17 85.10
IUUC-Lma-053059 Leptosphaeria maculans 37.97 1.00e-13 72.80
IUUC-Laf-053857 Loxodonta africana 37.68 3.00e-22 101.00
IUUC-Mcc-054873 Macaca mulatta 39.10 1.00e-22 102.00
IUUC-Meu-056858 Macropus eugenii 38.54 2.00e-14 75.50
IUUC-Mor-057051 Magnaporthe oryzae 27.85 1.00e-08 56.20
IUUC-Mpo-057372 Magnaporthe poae 34.40 3.00e-15 78.20
IUUC-Mtr-058538 Medicago truncatula 42.41 0.00e+00 1372.00
IUUC-Mla-058963 Melampsora laricipopulina 23.20 3.00e-09 58.20
IUUC-Mga-060032 Meleagris gallopavo 47.50 8.00e-19 89.00
IUUC-Mvi-060535 Microbotryum violaceum 23.68 4.00e-08 54.70
IUUC-Mmr-061128 Microcebus murinus 38.97 1.00e-22 102.00
IUUC-Mdo-062136 Monodelphis domestica 47.50 1.00e-18 88.20
IUUC-Mmu-063389 Mus musculus 45.00 7.00e-22 99.80
IUUC-Mac-064773 Musa acuminata 51.95 0.00e+00 1788.00
IUUC-Mpu-066153 Mustela putorius furo 37.00 3.00e-17 84.30
IUUC-Mlu-068151 Myotis lucifugus 32.12 1.00e-17 86.30
IUUC-Nfi-068403 Neosartorya fischeri 39.13 1.00e-08 56.20
IUUC-Ncr-068864 Neurospora crassa 36.52 6.00e-17 84.00
IUUC-Nle-070031 Nomascus leucogenys 39.10 1.00e-22 102.00
IUUC-Opr-070551 Ochotona princeps 38.54 3.00e-14 74.70
IUUC-Ont-072035 Oreochromis niloticus 39.39 4.00e-19 90.90
IUUC-Oan-072893 Ornithorhynchus anatinus 36.36 9.00e-17 82.80
IUUC-Ocu-074930 Oryctolagus cuniculus 45.00 4.00e-22 100.00
IUUC-Oba-075295 Oryza barthii 98.79 0.00e+00 3827.00
IUUC-Obr-076117 Oryza brachyantha 87.18 0.00e+00 3486.00
IUUC-Ogl-077571 Oryza glaberrima 95.16 0.00e+00 3782.00
IUUC-Oin-079343 Oryza indica 97.47 0.00e+00 3749.00
IUUC-Olo-081056 Oryza longistaminata 97.14 0.00e+00 3757.00
IUUC-Ome-081738 Oryza meridionalis 94.62 0.00e+00 3617.00
IUUC-Oni-083099 Oryza nivara 98.54 0.00e+00 3818.00
IUUC-Opu-083202 Oryza punctata 89.12 0.00e+00 3576.00
IUUC-Oru-084471 Oryza rufipogon 98.59 0.00e+00 3816.00
IUUC-Osa-085336 Oryza sativa 95.61 0.00e+00 1785.00
IUUC-Ola-086515 Oryzias latipes 46.25 6.00e-18 85.50
IUUC-Oga-088432 Otolemur garnettii 37.00 3.00e-17 84.30
IUUC-Oar-089557 Ovis aries 37.50 2.00e-22 101.00
IUUC-Ptr-091366 Pan troglodytes 39.10 2.00e-22 101.00
IUUC-Pan-092184 Papio anubis 39.10 2.00e-22 102.00
IUUC-Psi-093049 Pelodiscus sinensis 36.00 2.00e-16 81.60
IUUC-Pma-094152 Petromyzon marinus 45.00 1.00e-13 71.20
IUUC-Pno-094877 Phaeosphaeria nodorum 39.24 3.00e-14 75.10
IUUC-Ppa-095715 Physcomitrella patens 32.74 0.00e+00 962.00
IUUC-Pfo-096524 Poecilia formosa 24.34 4.00e-15 77.40
IUUC-Pab-098783 Pongo abelii 47.50 1.00e-18 87.80
IUUC-Pop-099496 Populus trichocarpa 43.36 0.00e+00 952.00
IUUC-Pca-101009 Procavia capensis 47.50 3.00e-18 87.80
IUUC-Ppe-101802 Prunus persica 43.48 0.00e+00 1316.00
IUUC-Pva-102724 Pteropus vampyrus 36.76 3.00e-22 100.00
IUUC-Pgr-103372 Puccinia graminis 36.84 4.00e-10 61.20
IUUC-Ptt-103878 Puccinia triticina 47.83 4.00e-07 50.80
IUUC-Pte-104174 Pyrenophora teres 39.19 1.00e-13 73.20
IUUC-Pyt-104431 Pyrenophora triticirepentis 39.19 5.00e-14 74.30
IUUC-Rno-105474 Rattus norvegicus 39.58 9.00e-15 75.90
IUUC-Sce-106200 Saccharomyces cerevisiae 34.29 1.00e-07 53.10
IUUC-Sha-107406 Sarcophilus harrisii 47.50 2.00e-18 88.60
IUUC-Sja-108005 Schizosaccharomyces japonicus 42.72 5.00e-17 82.80
IUUC-Spo-108183 Schizosaccharomyces pombe 32.03 3.00e-17 84.70
IUUC-Smo-108719 Selaginella moellendorffii 34.99 0.00e+00 632.00
IUUC-Sit-110716 Setaria italica 75.73 0.00e+00 2956.00
IUUC-Sly-111286 Solanum lycopersicum 42.99 0.00e+00 1451.00
IUUC-Sar-112948 Sorex araneus 48.75 4.00e-19 89.70
IUUC-Sbi-114577 Sorghum bicolor 76.10 0.00e+00 2914.00
IUUC-Sre-115045 Sporisorium reilianum 35.06 2.00e-07 52.40
IUUC-Ssc-115768 Sus scrofa 38.54 3.00e-14 74.30
IUUC-Tgu-116949 Taeniopygia guttata 42.06 2.00e-21 98.60
IUUC-Tru-117782 Takifugu rubripes 39.00 1.00e-18 89.40
IUUC-Tsy-119177 Tarsius syrichta 38.54 3.00e-14 74.70
IUUC-Tni-120560 Tetraodon nigroviridis 46.34 2.00e-18 87.00
IUUC-Tca-121077 Theobroma cacao 43.62 0.00e+00 1467.00
IUUC-Tre-122137 Trichoderma reesei 39.24 1.00e-13 72.80
IUUC-Tvi-122272 Trichoderma virens 38.10 3.00e-15 78.60
IUUC-Tae-125358 Triticum aestivum 73.40 0.00e+00 2759.00
IUUC-Tur-126562 Triticum urartu 63.67 0.00e+00 1449.00
IUUC-Tme-127156 Tuber melanosporum 37.00 2.00e-14 75.50
IUUC-Tbe-127964 Tupaia belangeri 47.50 1.00e-18 88.20
IUUC-Ttr-128253 Tursiops truncatus 38.00 1.00e-17 86.30
IUUC-Uma-129344 Ustilago maydis 42.25 1.00e-15 79.70
IUUC-Vda-129778 Verticillium dahliae 36.21 1.00e-15 79.70
IUUC-Vpa-130578 Vicugna pacos 38.54 4.00e-14 74.30
IUUC-Vvi-131290 Vitis vinifera 41.36 0.00e+00 1110.00
IUUC-Xtr-132335 Xenopus tropicalis 47.50 9.00e-19 88.60
IUUC-Xma-134112 Xiphophorus maculatus 39.39 2.00e-18 89.00
IUUC-Yli-134662 Yarrowia lipolytica 29.17 2.00e-12 68.90
IUUC-Zma-135553 Zea mays 74.00 0.00e+00 2799.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved