• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • AREsite
    • miRTarBase
    • microRNA
    • TRANSFAC
    • RepTar
    • RAID2
  • PPI
    • IID
    • iRefIndex
    • PINA
    • HINT
    • Mentha
  • PTM
    • CPLM
    • dbPAF
    • PhosphositePlus
    • dbPTM
    • UniProt
    • PHOSIDA
    • mUbiSiDa
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Ate-010375
Ensembl Protein ID CADATEAP00009253
UniProt Accession Q0CA59; SKP1_ASPTN
Genbank Protein ID EAU30562.1
Protein Name E3 ubiquitin ligase complex SCF subunit sconC; Sulfur controller C; Sulfur metabolite repression control protein C
Genbank Nucleotide ID CH476607
Gene Name ATEG_09425; sconC; skpA
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
CADATEAG00009253 CADATEAT00009253 CADATEAP00009253
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 2.70e-31 106.6 112 159
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 1    ksLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    k+LLd++cktVa+mikgk+peeiRktFni+nDftpeEe+++R+En+WA
   Q: 112 KGLLDVGCKTVANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWA 159
    89*********************************************9 PP
   

Organism Aspergillus terreus
Functional Description
(View)

Functional Description



     Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor (By similarity).
Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor (By similarity).
Protein Sequence
(Fasta)
MSTSPTLVFT SSDGVDITVD RDVAERSLLI KNMLEDLGET GEAIPIPNVN EAVLKKVIEW 60
CTHHKNDPPS TGDDDDSRRK TTDIDEWDQK FMQVDQEMLF EIILAANYLD IKGLLDVGCK 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Ate-010375|E3,SKP1|Aspergillus terreus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCGACTT CTCCCACTCT CGTCTTCACC AGCTCCGACG GTGTCGACAT CACGGTTGGT 60
ACGTTCATCA TCCTTGCAAT GTGCCGAGAT ATGTGCCCAC CAACTGACCT CTTCTCATGC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Ate-010375|E3,SKP1|Aspergillus terreus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0016567--P:protein ubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001036 Aegilops tauschii 53.21 8.00e-44 167.00
IUUC-Aml-002023 Ailuropoda melanoleuca 63.98 1.00e-47 180.00
IUUC-Atr-002858 Amborella trichopoda 53.55 1.00e-35 140.00
IUUC-Apl-003393 Anas platyrhynchos 63.98 1.00e-47 180.00
IUUC-Aca-004709 Anolis carolinensis 63.98 1.00e-47 180.00
IUUC-Aly-006236 Arabidopsis lyrata 48.15 2.00e-39 153.00
IUUC-Ath-007456 Arabidopsis thaliana 49.69 1.00e-40 157.00
IUUC-Ago-007847 Ashbya gossypii 54.34 7.00e-50 187.00
IUUC-Acl-008178 Aspergillus clavatus 94.30 1.00e-86 309.00
IUUC-Afl-008452 Aspergillus flavus 94.97 4.00e-87 311.00
IUUC-Afu-008785 Aspergillus fumigatus 94.87 1.00e-85 306.00
IUUC-Ani-009312 Aspergillus nidulans 85.81 2.00e-69 252.00
IUUC-Aor-010012 Aspergillus oryzae 94.97 4.00e-87 311.00
IUUC-Ame-011025 Astyanax mexicanus 64.60 4.00e-48 181.00
IUUC-Bgr-012280 Blumeria graminis 73.43 2.00e-48 182.00
IUUC-Bta-013519 Bos taurus 63.98 1.00e-47 180.00
IUUC-Bci-013888 Botrytis cinerea 78.69 3.00e-44 169.00
IUUC-Bdi-014547 Brachypodium distachyon 50.62 1.00e-35 140.00
IUUC-Bol-015959 Brassica oleracea 49.38 6.00e-37 144.00
IUUC-Bra-017062 Brassica rapa 52.17 4.00e-26 108.00
IUUC-Cel-018653 Caenorhabditis elegans 68.60 3.00e-48 182.00
IUUC-Cja-019785 Callithrix jacchus 63.82 5.00e-43 164.00
IUUC-Cfa-020931 Canis familiaris 63.98 1.00e-47 180.00
IUUC-Cpo-022487 Cavia porcellus 63.75 2.00e-46 176.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 55.35 2.00e-40 155.00
IUUC-Csa-023459 Chlorocebus sabaeus 63.35 3.00e-47 179.00
IUUC-Cho-024854 Choloepus hoffmanni 58.73 3.00e-14 68.60
IUUC-Cin-025538 Ciona intestinalis 61.25 3.00e-46 175.00
IUUC-Csv-025865 Ciona savignyi 60.62 1.00e-50 189.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 75.89 1.00e-59 219.00
IUUC-Cne-027058 Cryptococcus neoformans 68.75 2.00e-61 226.00
IUUC-Cme-027174 Cyanidioschyzon merolae 44.37 1.00e-33 133.00
IUUC-Dre-027756 Danio rerio 64.60 4.00e-48 181.00
IUUC-Dno-028924 Dasypus novemcinctus 63.98 1.00e-47 180.00
IUUC-Dor-030847 Dipodomys ordii 57.14 2.00e-42 162.00
IUUC-Dse-031209 Dothistroma septosporum 77.50 7.00e-66 240.00
IUUC-Dme-032028 Drosophila melanogaster 55.62 2.00e-48 182.00
IUUC-Ete-033117 Echinops telfairi 61.49 7.00e-45 171.00
IUUC-Eca-033320 Equus caballus 63.98 1.00e-47 180.00
IUUC-Eeu-034817 Erinaceus europaeus 70.45 2.00e-14 68.20
IUUC-Fca-035423 Felis catus 63.98 1.00e-47 180.00
IUUC-Fal-036956 Ficedula albicollis 63.98 1.00e-47 180.00
IUUC-Fox-037761 Fusarium oxysporum 76.16 1.00e-60 223.00
IUUC-Fso-038451 Fusarium solani 71.90 2.00e-59 219.00
IUUC-Gmo-039178 Gadus morhua 64.60 4.00e-48 181.00
IUUC-Ggr-039831 Gaeumannomyces graminis 74.65 4.00e-57 211.00
IUUC-Gga-040238 Gallus gallus 63.98 1.00e-47 180.00
IUUC-Gac-041965 Gasterosteus aculeatus 64.60 4.00e-48 181.00
IUUC-Gma-043086 Glycine max 52.44 8.00e-38 147.00
IUUC-Ggo-045025 Gorilla gorilla 63.98 1.00e-47 180.00
IUUC-Hsa-046875 Homo sapiens 63.98 1.00e-47 180.00
IUUC-Hvu-047497 Hordeum vulgare 51.57 4.00e-38 148.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 62.11 2.00e-46 176.00
IUUC-Kpa-049138 Komagataella pastoris 54.79 2.00e-49 186.00
IUUC-Lch-050522 Latimeria chalumnae 65.81 1.00e-51 193.00
IUUC-Lpe-050697 Leersia perrieri 47.44 4.00e-37 145.00
IUUC-Loc-052596 Lepisosteus oculatus 64.60 4.00e-48 181.00
IUUC-Lma-053020 Leptosphaeria maculans 78.42 1.00e-56 209.00
IUUC-Laf-053847 Loxodonta africana 63.98 1.00e-47 180.00
IUUC-Mor-057176 Magnaporthe oryzae 75.35 9.00e-58 214.00
IUUC-Mpo-057471 Magnaporthe poae 74.65 3.00e-57 212.00
IUUC-Mtr-058458 Medicago truncatula 47.50 1.00e-38 150.00
IUUC-Mla-059153 Melampsora laricipopulina 69.03 1.00e-56 210.00
IUUC-Mga-059864 Meleagris gallopavo 63.98 1.00e-47 180.00
IUUC-Mvi-060342 Microbotryum violaceum 69.75 4.00e-62 228.00
IUUC-Mdo-062509 Monodelphis domestica 63.98 1.00e-47 180.00
IUUC-Mmu-063694 Mus musculus 64.60 4.00e-48 181.00
IUUC-Mac-064905 Musa acuminata 55.56 1.00e-37 146.00
IUUC-Mpu-065990 Mustela putorius furo 63.98 1.00e-47 180.00
IUUC-Mlu-068168 Myotis lucifugus 63.98 1.00e-47 180.00
IUUC-Nfi-068309 Neosartorya fischeri 94.87 1.00e-85 306.00
IUUC-Ncr-068658 Neurospora crassa 77.46 3.00e-61 225.00
IUUC-Nle-070101 Nomascus leucogenys 63.98 1.00e-47 180.00
IUUC-Opr-070881 Ochotona princeps 63.98 1.00e-47 180.00
IUUC-Ont-071529 Oreochromis niloticus 64.60 4.00e-48 181.00
IUUC-Oan-073000 Ornithorhynchus anatinus 84.21 1.00e-25 105.00
IUUC-Ocu-073780 Oryctolagus cuniculus 63.98 1.00e-47 180.00
IUUC-Oba-075110 Oryza barthii 44.44 2.00e-34 135.00
IUUC-Obr-076218 Oryza brachyantha 54.38 2.00e-37 146.00
IUUC-Ogl-077257 Oryza glaberrima 46.25 1.00e-37 146.00
IUUC-Ogu-078125 Oryza glumaepatula 47.37 1.00e-33 133.00
IUUC-Oin-080141 Oryza indica 46.25 1.00e-37 146.00
IUUC-Olo-080834 Oryza longistaminata 42.38 9.00e-34 134.00
IUUC-Ome-081330 Oryza meridionalis 47.65 6.00e-34 134.00
IUUC-Oni-082067 Oryza nivara 46.21 3.00e-34 135.00
IUUC-Opu-083354 Oryza punctata 49.14 2.00e-34 136.00
IUUC-Oru-084769 Oryza rufipogon 44.44 8.00e-35 137.00
IUUC-Osa-085479 Oryza sativa 44.44 8.00e-35 137.00
IUUC-Ola-087270 Oryzias latipes 64.60 4.00e-48 181.00
IUUC-Olu-087667 Ostreococcus lucimarinus 51.28 3.00e-41 158.00
IUUC-Oga-089073 Otolemur garnettii 63.98 1.00e-47 180.00
IUUC-Oar-089391 Ovis aries 59.75 1.00e-41 160.00
IUUC-Ptr-090872 Pan troglodytes 62.50 3.00e-46 175.00
IUUC-Pan-091780 Papio anubis 63.98 1.00e-47 180.00
IUUC-Psi-093135 Pelodiscus sinensis 63.98 1.00e-47 180.00
IUUC-Pno-094810 Phaeosphaeria nodorum 77.14 3.00e-52 195.00
IUUC-Ppa-095244 Physcomitrella patens 55.63 9.00e-39 150.00
IUUC-Pfo-097529 Poecilia formosa 64.60 4.00e-48 181.00
IUUC-Pab-098533 Pongo abelii 63.98 1.00e-47 180.00
IUUC-Pop-099187 Populus trichocarpa 54.94 5.00e-40 154.00
IUUC-Pca-100783 Procavia capensis 54.66 8.00e-37 144.00
IUUC-Ppe-101410 Prunus persica 49.03 1.00e-38 149.00
IUUC-Pva-102901 Pteropus vampyrus 63.98 1.00e-47 180.00
IUUC-Pgr-103499 Puccinia graminis 66.67 4.00e-56 208.00
IUUC-Ptt-103874 Puccinia triticina 74.42 5.00e-54 202.00
IUUC-Pte-104224 Pyrenophora teres 81.43 1.00e-51 193.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 76.87 7.00e-52 194.00
IUUC-Rno-105499 Rattus norvegicus 64.60 4.00e-48 181.00
IUUC-Sce-106387 Saccharomyces cerevisiae 50.26 4.00e-46 175.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 70.51 2.00e-61 225.00
IUUC-Spo-108033 Schizosaccharomyces pombe 70.32 4.00e-60 221.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 77.03 3.00e-63 231.00
IUUC-Smo-109307 Selaginella moellendorffii 54.66 3.00e-38 149.00
IUUC-Sit-110435 Setaria italica 50.31 5.00e-35 138.00
IUUC-Sly-111529 Solanum lycopersicum 53.09 4.00e-37 145.00
IUUC-Stu-112023 Solanum tuberosum 53.21 1.00e-36 143.00
IUUC-Sar-112973 Sorex araneus 58.39 9.00e-40 154.00
IUUC-Sbi-114394 Sorghum bicolor 51.55 4.00e-38 148.00
IUUC-Sre-115178 Sporisorium reilianum 74.03 2.00e-66 242.00
IUUC-Tgu-116474 Taeniopygia guttata 63.98 1.00e-47 180.00
IUUC-Tru-118429 Takifugu rubripes 63.98 4.00e-48 181.00
IUUC-Tsy-118896 Tarsius syrichta 63.98 1.00e-47 180.00
IUUC-Tni-119960 Tetraodon nigroviridis 63.98 4.00e-48 181.00
IUUC-Tca-121022 Theobroma cacao 52.80 3.00e-38 148.00
IUUC-Tre-122004 Trichoderma reesei 69.80 8.00e-51 190.00
IUUC-Tvi-122449 Trichoderma virens 70.27 7.00e-51 191.00
IUUC-Tae-125854 Triticum aestivum 53.21 8.00e-44 167.00
IUUC-Tur-126421 Triticum urartu 54.55 1.00e-40 156.00
IUUC-Tme-127078 Tuber melanosporum 80.39 8.00e-62 227.00
IUUC-Tbe-127720 Tupaia belangeri 63.98 1.00e-47 180.00
IUUC-Ttr-129035 Tursiops truncatus 63.98 1.00e-47 180.00
IUUC-Uma-129517 Ustilago maydis 73.38 9.00e-65 236.00
IUUC-Vda-129691 Verticillium dahliae 72.67 3.00e-54 202.00
IUUC-Vpa-130128 Vicugna pacos 63.98 1.00e-47 180.00
IUUC-Vvi-130876 Vitis vinifera 52.80 7.00e-44 167.00
IUUC-Xtr-132393 Xenopus tropicalis 63.98 1.00e-47 180.00
IUUC-Xma-133603 Xiphophorus maculatus 64.60 4.00e-48 181.00
IUUC-Yli-134499 Yarrowia lipolytica 68.75 1.00e-61 226.00
IUUC-Zma-134722 Zea mays 45.78 6.00e-33 132.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved