• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
  • DNA & RNA Element
    • microRNA
    • TRANSFAC
    • RAID2
  • PPI
    • IID
  • Drug & target
    • GRAC
  • PTM
    • dbPAF
    • PhosphositePlus
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Laf-053758
Ensembl Protein ID ENSLAFP00000021788.1
UniProt Accession G3U1T0; G3U1T0_LOXAF
Protein Name Presenilin
Gene Name PSEN2
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSLAFG00000007445.3 ENSLAFT00000028050.1 ENSLAFP00000021788.1
ENSLAFG00000007445.3 ENSLAFT00000007446.3 ENSLAFP00000006262.3
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/Alpha-Helix/CUE 3.40e-07 30.5 278 316
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/Alpha-Helix/CUE

   S: 2    letaleqLkeiFPnldysviqvvLeantgsleaavnnLL 40
    +eta+e++++iFP+l+ys+ +v+ + +++ +++++++L
   Q: 278 VETAQERNEPIFPALIYSSAMVWTVGMAKPDPSSQGALQ 316
    89*************************999999888875 PP
   

Organism Loxodonta africana
Functional Description
(View)

Functional Description



     Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
Protein Sequence
(Fasta)
MLTFMASDSE EEVCDERTSL MSAESPTPRT HQEGRQGPED AENTTQWRSQ ENEEDCEEDP 60
DRYVCSGVPG RPSGLEEELT LKYGAKHVIM LFVPVTLCMV VVVATIKSVR FYTEKNGQLI 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Laf-053758|UBD,CUE|Loxodonta africana
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGCTCACAT TCATGGCCTC TGACAGCGAG GAGGAAGTGT GTGACGAGAG GACCTCCCTG 60
ATGTCGGCTG AGAGCCCCAC ACCGCGCACC CACCAGGAGG GCAGGCAGGG CCCGGAGGAC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Laf-053758|UBD,CUE|Loxodonta africana
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0256--Endoplasmic reticulum
KW-0333--Golgi apparatus
KW-0378--Hydrolase
KW-0472--Membrane
KW-0914--Notch signaling pathway
KW-0645--Protease
KW-1185--Reference proteome
KW-0812--Transmembrane
KW-1133--Transmembrane helix

Interpro

IPR001493--Pept_A22A_PS2
IPR001108--Peptidase_A22A
IPR006639--Preselin/SPP

Pfam

PF01080--Presenilin

PRINTS

PR01072--PRESENILIN
PR01074--PRESENILIN2

SMART

SM00730--PSN

Gene Ontology

GO:0005813--C:centrosome
GO:0005789--C:endoplasmic reticulum membrane
GO:0000139--C:Golgi membrane
GO:0005887--C:integral component of plasma membrane
GO:0000776--C:kinetochore
GO:0005637--C:nuclear inner membrane
GO:0004190--F:aspartic-type endopeptidase activity
GO:0035556--P:intracellular signal transduction
GO:0006509--P:membrane protein ectodomain proteolysis
GO:0007219--P:Notch signaling pathway
GO:0043085--P:positive regulation of catalytic activity
GO:0016485--P:protein processing

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Aml-002356 Ailuropoda melanoleuca 82.04 9.00e-169 586.00
IUUC-Atr-003039 Amborella trichopoda 30.97 1.00e-35 144.00
IUUC-Apl-003959 Anas platyrhynchos 74.53 3.00e-162 564.00
IUUC-Aca-005160 Anolis carolinensis 74.62 3.00e-166 578.00
IUUC-Ath-006730 Arabidopsis thaliana 31.63 2.00e-18 87.00
IUUC-Ame-010686 Astyanax mexicanus 79.18 9.00e-149 519.00
IUUC-Bta-013097 Bos taurus 88.52 0.00e+00 679.00
IUUC-Bol-015841 Brassica oleracea 31.25 1.00e-29 123.00
IUUC-Cel-018553 Caenorhabditis elegans 48.16 2.00e-93 336.00
IUUC-Cja-018824 Callithrix jacchus 89.16 0.00e+00 700.00
IUUC-Cfa-020253 Canis familiaris 88.91 0.00e+00 699.00
IUUC-Cpo-021401 Cavia porcellus 88.27 0.00e+00 699.00
IUUC-Cre-022747 Chlamydomonas reinhardtii 33.33 8.00e-30 125.00
IUUC-Csa-023369 Chlorocebus sabaeus 91.13 0.00e+00 718.00
IUUC-Cin-025780 Ciona intestinalis 61.15 1.00e-120 426.00
IUUC-Csv-025967 Ciona savignyi 61.67 2.00e-122 431.00
IUUC-Dre-028526 Danio rerio 69.21 1.00e-147 515.00
IUUC-Dor-031127 Dipodomys ordii 85.14 0.00e+00 670.00
IUUC-Dme-031929 Drosophila melanogaster 53.19 8.00e-110 390.00
IUUC-Ete-033081 Echinops telfairi 76.14 2.00e-86 312.00
IUUC-Eca-034387 Equus caballus 88.69 0.00e+00 658.00
IUUC-Eeu-034846 Erinaceus europaeus 78.04 2.00e-139 489.00
IUUC-Fca-035396 Felis catus 88.44 0.00e+00 695.00
IUUC-Fal-037457 Ficedula albicollis 75.33 5.00e-162 563.00
IUUC-Gmo-038550 Gadus morhua 82.83 2.00e-106 379.00
IUUC-Gga-040706 Gallus gallus 75.98 2.00e-160 558.00
IUUC-Gac-042511 Gasterosteus aculeatus 66.04 4.00e-135 474.00
IUUC-Gma-043822 Glycine max 35.64 2.00e-23 102.00
IUUC-Ggo-045338 Gorilla gorilla 91.35 0.00e+00 718.00
IUUC-Hsa-046455 Homo sapiens 91.35 0.00e+00 718.00
IUUC-Itr-048731 Ictidomys tridecemlineatus 90.02 0.00e+00 709.00
IUUC-Lch-049638 Latimeria chalumnae 67.31 3.00e-143 501.00
IUUC-Loc-052427 Lepisosteus oculatus 73.67 2.00e-160 558.00
IUUC-Mcc-054755 Macaca mulatta 91.13 0.00e+00 716.00
IUUC-Mtr-058392 Medicago truncatula 35.62 1.00e-34 140.00
IUUC-Mmr-060890 Microcebus murinus 88.47 0.00e+00 696.00
IUUC-Mdo-062197 Monodelphis domestica 76.86 2.00e-172 598.00
IUUC-Mmu-063823 Mus musculus 89.36 0.00e+00 714.00
IUUC-Mac-064858 Musa acuminata 40.91 5.00e-21 94.70
IUUC-Mpu-066181 Mustela putorius furo 89.14 0.00e+00 701.00
IUUC-Nle-069596 Nomascus leucogenys 90.20 0.00e+00 669.00
IUUC-Opr-070344 Ochotona princeps 88.27 0.00e+00 691.00
IUUC-Ont-071867 Oreochromis niloticus 69.42 1.00e-134 473.00
IUUC-Oan-073378 Ornithorhynchus anatinus 72.64 1.00e-154 539.00
IUUC-Ocu-074652 Oryctolagus cuniculus 89.36 0.00e+00 670.00
IUUC-Obr-076302 Oryza brachyantha 36.96 1.00e-17 84.70
IUUC-Ola-086707 Oryzias latipes 67.51 9.00e-108 382.00
IUUC-Olu-087811 Ostreococcus lucimarinus 37.43 6.00e-45 174.00
IUUC-Oga-088560 Otolemur garnettii 89.16 0.00e+00 677.00
IUUC-Oar-089200 Ovis aries 88.08 0.00e+00 656.00
IUUC-Ptr-090569 Pan troglodytes 91.13 0.00e+00 716.00
IUUC-Pan-091742 Papio anubis 91.13 0.00e+00 716.00
IUUC-Pma-094612 Petromyzon marinus 75.85 1.00e-126 446.00
IUUC-Ppa-095431 Physcomitrella patens 31.52 2.00e-27 116.00
IUUC-Pab-098531 Pongo abelii 91.13 0.00e+00 718.00
IUUC-Pop-099661 Populus trichocarpa 32.51 3.00e-35 142.00
IUUC-Pca-101120 Procavia capensis 88.91 0.00e+00 702.00
IUUC-Pva-102934 Pteropus vampyrus 82.26 0.00e+00 664.00
IUUC-Rno-106052 Rattus norvegicus 89.14 0.00e+00 725.00
IUUC-Sha-106876 Sarcophilus harrisii 76.50 5.00e-171 593.00
IUUC-Smo-109325 Selaginella moellendorffii 35.03 7.00e-34 137.00
IUUC-Ssc-115380 Sus scrofa 90.24 0.00e+00 731.00
IUUC-Tgu-117280 Taeniopygia guttata 75.76 1.00e-163 569.00
IUUC-Tca-121865 Theobroma cacao 32.50 3.00e-39 155.00
IUUC-Tbe-127632 Tupaia belangeri 93.39 2.00e-171 594.00
IUUC-Ttr-129008 Tursiops truncatus 88.91 0.00e+00 691.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved