• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • RAID2
  • PTM
    • dbPAF
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Fca-035464
Ensembl Protein ID ENSFCAP00000021802.1
UniProt Accession M3X5A1; M3X5A1_FELCA
Genbank Protein ID ENSFCAP00000021802
Protein Name Uncharacterized protein
Genbank Nucleotide ID AANG02159327
Gene Name N4BP2
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSFCAG00000024887.1 ENSFCAT00000023716.1 ENSFCAP00000021802.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/Alpha-Helix/CUE 1.90e-09 37.3 46 88
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/Alpha-Helix/CUE

   S: 1    dletaleqLkeiFPnldysviqvvLeantgsleaavnnLLegs 43
    d+e++++ + e+F +ld++v++ +L+++++ +e+a+++LLe+s
   Q: 46 DQEELFTSISEMFSDLDPDVVYLMLSECDFKVENAMDCLLELS 88
    689**************************************97 PP
   

Organism Felis catus
Protein Sequence
(Fasta)
MPRRRKNLGG NPFRKTASSK EVVVSSVASH EEPTTTLPSM CETKVDQEEL FTSISEMFSD 60
LDPDVVYLML SECDFKVENA MDCLLELSAS DAKVEESSSK SFIASESQVS AVGREIMEKY 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Fca-035464|UBD,CUE|Felis catus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGCCGAGGA GAAGGAAAAA TCTTGGGGGA AATCCTTTTC GGAAGACCGC AAGCTCTAAG 60
GAAGTTGTCG TATCCAGTGT TGCTAGTCAT GAGGAGCCAA CCACTACTCT TCCTTCCATG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Fca-035464|UBD,CUE|Felis catus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003892--CUE
IPR013899--DUF1771
IPR027417--P-loop_NTPase
IPR002625--Smr_dom
IPR009060--UBA-like

PROSITE

PS51140--CUE
PS50828--SMR

Pfam

PF02845--CUE
PF08590--DUF1771
PF01713--Smr

SMART

SM01162--DUF1771
SM00463--SMR

Gene Ontology

GO:0005829--C:cytosol
GO:0005524--F:ATP binding
GO:0046404--F:ATP-dependent polydeoxyribonucleotide 5'-hydroxyl-kinase activity
GO:0004519--F:endonuclease activity

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000307 Aegilops tauschii 30.32 4.00e-14 72.80
IUUC-Aml-001291 Ailuropoda melanoleuca 89.29 0.00e+00 2925.00
IUUC-Atr-002800 Amborella trichopoda 32.70 8.00e-13 68.60
IUUC-Apl-003628 Anas platyrhynchos 46.58 0.00e+00 732.00
IUUC-Aca-005334 Anolis carolinensis 62.53 4.00e-146 513.00
IUUC-Aly-006196 Arabidopsis lyrata 29.63 3.00e-11 63.50
IUUC-Ath-006720 Arabidopsis thaliana 29.63 2.00e-11 63.90
IUUC-Ago-007797 Ashbya gossypii 31.25 2.00e-09 55.80
IUUC-Acl-008358 Aspergillus clavatus 30.97 2.00e-13 70.90
IUUC-Afl-008652 Aspergillus flavus 32.26 8.00e-13 68.90
IUUC-Afu-008968 Aspergillus fumigatus 30.32 4.00e-13 70.10
IUUC-Ang-009527 Aspergillus niger 30.97 3.00e-13 70.50
IUUC-Aor-010090 Aspergillus oryzae 32.26 8.00e-13 68.90
IUUC-Ate-010565 Aspergillus terreus 30.97 5.00e-13 69.70
IUUC-Ame-011671 Astyanax mexicanus 51.12 1.00e-102 368.00
IUUC-Bgr-012080 Blumeria graminis 30.07 2.00e-10 59.30
IUUC-Bta-013181 Bos taurus 81.20 0.00e+00 2542.00
IUUC-Bci-013717 Botrytis cinerea 33.85 1.00e-11 63.20
IUUC-Bdi-014201 Brachypodium distachyon 29.68 4.00e-14 72.80
IUUC-Bol-015623 Brassica oleracea 32.52 4.00e-13 69.30
IUUC-Bra-017329 Brassica rapa 32.70 4.00e-12 65.90
IUUC-Cja-019184 Callithrix jacchus 77.32 0.00e+00 2519.00
IUUC-Cfa-021092 Canis familiaris 88.17 0.00e+00 2827.00
IUUC-Cpo-022517 Cavia porcellus 65.84 0.00e+00 1808.00
IUUC-Csa-024113 Chlorocebus sabaeus 79.00 0.00e+00 2587.00
IUUC-Cho-025097 Choloepus hoffmanni 74.04 0.00e+00 2127.00
IUUC-Cgl-026652 Colletotrichum gloeosporioides 30.87 2.00e-10 61.20
IUUC-Cme-027204 Cyanidioschyzon merolae 31.91 2.00e-12 65.10
IUUC-Dre-028125 Danio rerio 48.76 6.00e-91 329.00
IUUC-Dno-028869 Dasypus novemcinctus 75.04 0.00e+00 2404.00
IUUC-Dor-030516 Dipodomys ordii 67.23 0.00e+00 1758.00
IUUC-Dse-031379 Dothistroma septosporum 35.38 2.00e-10 58.90
IUUC-Ete-032277 Echinops telfairi 56.41 0.00e+00 780.00
IUUC-Eca-034418 Equus caballus 83.83 0.00e+00 2624.00
IUUC-Fal-036958 Ficedula albicollis 43.53 0.00e+00 727.00
IUUC-Fox-037804 Fusarium oxysporum 26.04 4.40e-02 32.30
IUUC-Fso-038365 Fusarium solani 26.00 3.00e-03 36.60
IUUC-Ggr-039919 Gaeumannomyces graminis 28.68 1.00e-03 37.40
IUUC-Gga-040829 Gallus gallus 62.96 1.00e-152 534.00
IUUC-Gma-043695 Glycine max 32.92 3.00e-15 76.60
IUUC-Ggo-045014 Gorilla gorilla 72.28 0.00e+00 2278.00
IUUC-Hsa-046049 Homo sapiens 79.23 0.00e+00 2622.00
IUUC-Hvu-047315 Hordeum vulgare 30.32 3.00e-14 73.60
IUUC-Itr-047979 Ictidomys tridecemlineatus 80.12 0.00e+00 2028.00
IUUC-Kpa-049234 Komagataella pastoris 34.33 2.00e-09 55.80
IUUC-Lch-050089 Latimeria chalumnae 41.84 0.00e+00 632.00
IUUC-Lpe-050913 Leersia perrieri 28.30 3.00e-13 69.70
IUUC-Loc-052313 Lepisosteus oculatus 53.17 2.00e-112 401.00
IUUC-Laf-054208 Loxodonta africana 70.06 0.00e+00 1897.00
IUUC-Mcc-055097 Macaca mulatta 79.56 0.00e+00 2585.00
IUUC-Meu-056220 Macropus eugenii 44.23 2.00e-102 367.00
IUUC-Mor-057049 Magnaporthe oryzae 23.85 2.80e-02 33.10
IUUC-Mtr-057639 Medicago truncatula 32.73 6.00e-14 72.40
IUUC-Mla-058827 Melampsora laricipopulina 34.00 3.00e-12 63.50
IUUC-Mga-060071 Meleagris gallopavo 64.25 2.00e-155 543.00
IUUC-Mmu-063261 Mus musculus 68.91 0.00e+00 2060.00
IUUC-Mac-065582 Musa acuminata 30.62 1.00e-15 77.80
IUUC-Mpu-066564 Mustela putorius furo 87.22 0.00e+00 2238.00
IUUC-Mlu-067134 Myotis lucifugus 81.71 0.00e+00 2632.00
IUUC-Nfi-068329 Neosartorya fischeri 38.46 6.00e-15 73.90
IUUC-Ncr-068888 Neurospora crassa 35.38 3.00e-12 65.50
IUUC-Nle-070076 Nomascus leucogenys 79.00 0.00e+00 2551.00
IUUC-Opr-071217 Ochotona princeps 64.97 0.00e+00 1978.00
IUUC-Ont-072331 Oreochromis niloticus 48.76 5.00e-102 366.00
IUUC-Oan-073398 Ornithorhynchus anatinus 45.45 0.00e+00 955.00
IUUC-Ocu-074175 Oryctolagus cuniculus 71.74 0.00e+00 1659.00
IUUC-Oba-074981 Oryza barthii 29.22 2.00e-14 73.90
IUUC-Obr-076223 Oryza brachyantha 30.32 4.00e-15 76.30
IUUC-Ogl-077577 Oryza glaberrima 29.22 2.00e-14 73.90
IUUC-Ogu-078879 Oryza glumaepatula 29.33 1.00e-13 71.60
IUUC-Oin-079288 Oryza indica 29.22 2.00e-14 73.90
IUUC-Olo-080622 Oryza longistaminata 29.22 2.00e-14 74.30
IUUC-Ome-081674 Oryza meridionalis 29.33 1.00e-13 71.60
IUUC-Oni-082814 Oryza nivara 29.87 1.00e-14 74.70
IUUC-Opu-083966 Oryza punctata 29.41 5.00e-13 71.20
IUUC-Oru-084603 Oryza rufipogon 29.22 2.00e-14 73.90
IUUC-Osa-086109 Oryza sativa 29.22 2.00e-14 73.90
IUUC-Oga-089167 Otolemur garnettii 75.24 0.00e+00 2355.00
IUUC-Oar-090067 Ovis aries 80.96 0.00e+00 2593.00
IUUC-Ptr-091648 Pan troglodytes 79.28 0.00e+00 2624.00
IUUC-Pan-092074 Papio anubis 78.57 0.00e+00 2539.00
IUUC-Psi-094006 Pelodiscus sinensis 45.80 0.00e+00 944.00
IUUC-Pma-094605 Petromyzon marinus 43.20 4.00e-86 313.00
IUUC-Pno-094845 Phaeosphaeria nodorum 36.15 5.00e-13 69.70
IUUC-Ppa-095472 Physcomitrella patens 31.25 5.00e-15 76.30
IUUC-Pfo-096653 Poecilia formosa 46.71 3.00e-102 367.00
IUUC-Pab-097841 Pongo abelii 78.84 0.00e+00 2594.00
IUUC-Pop-099018 Populus trichocarpa 32.73 1.00e-13 71.20
IUUC-Pca-100710 Procavia capensis 68.36 0.00e+00 885.00
IUUC-Ppe-101241 Prunus persica 31.58 2.00e-12 67.00
IUUC-Pva-102564 Pteropus vampyrus 78.31 0.00e+00 2468.00
IUUC-Ptt-103766 Puccinia triticina 53.33 2.20e+00 26.60
IUUC-Rno-105882 Rattus norvegicus 68.16 0.00e+00 2045.00
IUUC-Sce-106211 Saccharomyces cerevisiae 29.76 1.00e-03 37.70
IUUC-Sha-107043 Sarcophilus harrisii 49.05 0.00e+00 1250.00
IUUC-Sja-107849 Schizosaccharomyces japonicus 33.57 8.00e-12 63.50
IUUC-Spo-108072 Schizosaccharomyces pombe 30.23 1.00e-07 51.20
IUUC-Ssl-108444 Sclerotinia sclerotiorum 33.08 2.00e-09 56.20
IUUC-Smo-108891 Selaginella moellendorffii 35.00 2.00e-18 87.00
IUUC-Sit-109705 Setaria italica 31.82 2.00e-10 60.80
IUUC-Sly-111484 Solanum lycopersicum 31.06 3.00e-14 73.20
IUUC-Stu-112625 Solanum tuberosum 31.06 3.00e-14 73.20
IUUC-Sar-113440 Sorex araneus 71.45 0.00e+00 2199.00
IUUC-Sbi-114730 Sorghum bicolor 29.68 9.00e-14 71.60
IUUC-Sre-115226 Sporisorium reilianum 31.11 7.00e-10 57.80
IUUC-Ssc-115744 Sus scrofa 81.95 0.00e+00 2136.00
IUUC-Tgu-116540 Taeniopygia guttata 43.13 0.00e+00 862.00
IUUC-Tru-118415 Takifugu rubripes 45.77 8.00e-102 365.00
IUUC-Tsy-119380 Tarsius syrichta 66.29 0.00e+00 863.00
IUUC-Tni-120411 Tetraodon nigroviridis 47.33 5.00e-101 363.00
IUUC-Tca-121821 Theobroma cacao 31.90 5.00e-12 65.90
IUUC-Tre-122107 Trichoderma reesei 35.38 1.00e-13 69.70
IUUC-Tvi-122309 Trichoderma virens 33.80 7.00e-13 67.40
IUUC-Tae-123527 Triticum aestivum 30.32 2.00e-14 73.60
IUUC-Tur-125957 Triticum urartu 30.97 3.00e-15 76.60
IUUC-Tme-126978 Tuber melanosporum 35.34 1.00e-15 75.90
IUUC-Tbe-127331 Tupaia belangeri 66.84 0.00e+00 685.00
IUUC-Ttr-128559 Tursiops truncatus 83.55 0.00e+00 2663.00
IUUC-Uma-129434 Ustilago maydis 29.20 3.00e-09 55.50
IUUC-Vda-129975 Verticillium dahliae 33.33 1.00e-12 66.60
IUUC-Vpa-130807 Vicugna pacos 79.84 0.00e+00 2149.00
IUUC-Vvi-131687 Vitis vinifera 29.88 2.00e-11 63.90
IUUC-Xma-133915 Xiphophorus maculatus 46.14 7.00e-102 365.00
IUUC-Yli-134541 Yarrowia lipolytica 34.21 2.00e-14 72.00
IUUC-Zma-134705 Zea mays 29.49 2.00e-07 50.40
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved