• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
  • PPI
    • iRefIndex
    • HINT
  • PTM
    • dbPAF
    • dbPTM
    • UniProt
  • Proteomics

Tag Content
iUUCD ID IUUC-Tme-127134
Ensembl Protein ID CAZ79853
UniProt Accession D5G5R0; D5G5R0_TUBMM
Genbank Protein ID CAZ79853.1
Protein Name Uncharacterized protein
Genbank Nucleotide ID FN430001
Gene Name GSTUM_00001442001
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
GSTUM_00001442001 CAZ79853 CAZ79853
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/Alpha-Helix/CUE 6.00e-06 24.9 61 97
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/Alpha-Helix/CUE

   S: 6    leqLkeiFPnldysviqvvLeantgsleaavnnLLeg 42
    l +L+e+FP++ ++ i L++n+g+++ + ++ eg
   Q: 61 LSRLQEMFPAWTPDDIVTALNENGGDVQLTASKISEG 97
    89****************************9999987 PP
   

Organism Tuber melanosporum
Protein Sequence
(Fasta)
MSEVQTRPPV HRGRGSSRGG RGGFPRPTRS SHTNGGSNAS YDTSDDQGEI GQLKRQYAAE 60
LSRLQEMFPA WTPDDIVTAL NENGGDVQLT ASKISEGTTA QWGTVEKRSK DRSRSKVKEP 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Tme-127134|UBD,CUE|Tuber melanosporum
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGTCTGAAG TGCAAACACG TCCTCCCGTC CATCGGGGTA GAGGCTCCTC TCGGGGTGGT 60
CGCGGTGGAT TCCCCAGACC TACCCGCAGT TCACACACAA ATGGAGGCAG TAATGCTTCT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Tme-127134|UBD,CUE|Tuber melanosporum
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003892--CUE

PROSITE

PS51140--CUE

Pfam

PF02845--CUE

KEGG tml:GSTUM_00001442001
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ago-007842 Ashbya gossypii 32.47 5.00e-06 44.70
IUUC-Acl-008346 Aspergillus clavatus 57.14 5.00e-20 91.30
IUUC-Afu-008947 Aspergillus fumigatus 59.00 8.00e-22 97.40
IUUC-Ani-009287 Aspergillus nidulans 46.33 5.00e-21 94.40
IUUC-Ang-009672 Aspergillus niger 44.62 6.00e-19 85.90
IUUC-Aor-010169 Aspergillus oryzae 55.24 1.00e-20 93.20
IUUC-Ate-010403 Aspergillus terreus 55.66 6.00e-21 94.40
IUUC-Bgr-012096 Blumeria graminis 47.76 5.00e-17 81.30
IUUC-Bci-013969 Botrytis cinerea 42.77 2.00e-18 86.30
IUUC-Cgl-026768 Colletotrichum gloeosporioides 44.74 4.00e-14 67.80
IUUC-Cne-026987 Cryptococcus neoformans 32.08 3.00e-04 38.90
IUUC-Dse-031419 Dothistroma septosporum 44.29 7.00e-22 97.40
IUUC-Fal-037573 Ficedula albicollis 29.82 1.60e+00 27.30
IUUC-Fox-038044 Fusarium oxysporum 41.23 1.00e-18 87.00
IUUC-Fso-038371 Fusarium solani 41.38 2.00e-14 72.40
IUUC-Ggr-040008 Gaeumannomyces graminis 52.05 1.00e-19 90.10
IUUC-Itr-048760 Ictidomys tridecemlineatus 29.82 4.40e-02 32.00
IUUC-Kpa-049227 Komagataella pastoris 31.82 4.10e-02 31.20
IUUC-Lma-053215 Leptosphaeria maculans 34.21 1.50e-02 30.40
IUUC-Mor-057258 Magnaporthe oryzae 42.53 5.00e-18 84.70
IUUC-Mpo-057575 Magnaporthe poae 50.00 4.00e-20 91.70
IUUC-Mla-058869 Melampsora laricipopulina 40.00 2.00e-13 67.00
IUUC-Mvi-060545 Microbotryum violaceum 39.02 6.00e-14 71.20
IUUC-Nfi-068569 Neosartorya fischeri 45.56 2.00e-20 92.40
IUUC-Ncr-068873 Neurospora crassa 49.15 1.00e-15 77.00
IUUC-Pno-095140 Phaeosphaeria nodorum 40.14 1.00e-16 80.10
IUUC-Pgr-103269 Puccinia graminis 39.34 8.00e-13 67.80
IUUC-Ptt-103757 Puccinia triticina 38.46 2.00e-09 56.60
IUUC-Pte-104043 Pyrenophora teres 54.55 7.00e-23 100.00
IUUC-Pyt-104760 Pyrenophora triticirepentis 55.68 4.00e-23 101.00
IUUC-Sce-106424 Saccharomyces cerevisiae 31.82 2.00e-04 39.70
IUUC-Sja-107853 Schizosaccharomyces japonicus 38.64 1.00e-06 47.00
IUUC-Spo-108061 Schizosaccharomyces pombe 44.44 7.00e-10 57.80
IUUC-Sre-115033 Sporisorium reilianum 36.49 1.00e-09 57.00
IUUC-Tre-121872 Trichoderma reesei 40.25 3.00e-12 65.90
IUUC-Tvi-122493 Trichoderma virens 39.68 2.00e-12 66.20
IUUC-Uma-129410 Ustilago maydis 36.49 6.00e-10 57.80
IUUC-Vda-129677 Verticillium dahliae 41.14 2.00e-13 69.70
IUUC-Yli-134616 Yarrowia lipolytica 36.71 9.00e-03 33.90
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved