• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • microRNA
    • RAID2
  • PPI
    • IID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Mcc-055682
Ensembl Protein ID ENSMMUP00000032752.2
UniProt Accession F7AGU8; H9EN77; F7AGU8_MACMU
Genbank Protein ID AFE63836.1; AFH28384.1; AFI33664.1
Protein Name Presenilin
Genbank Nucleotide ID JSUE03040026; JU471580; JV043593
Gene Name PSEN1
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMMUG00000010173.3 ENSMMUT00000039688.2 ENSMMUP00000032752.2
ENSMMUG00000010173.3 ENSMMUT00000014203.3 ENSMMUP00000013301.2
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/Alpha-Helix/CUE 2.60e-08 34.8 272 311
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/Alpha-Helix/CUE

   S: 2    letaleqLkeiFPnldysviqvvLeantgsleaavnnLLe 41
    +eta+e+++++FP+l+ys+++v+L++++ +++a+ + +
   Q: 272 VETAQERNETLFPALIYSSTMVWLVNMAEGDPEAQRRVSK 311
    89***************************99999987765 PP
   

Organism Macaca mulatta
Functional Description
(View)

Functional Description



     Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
Protein Sequence
(Fasta)
MTELPAPLSY FQNAQMSEDN HLSNTVRSQN DNRERQEHND RRSLGHPEPL SNGRPQGNSR 60
QVVEQDEEED EELTLKYGAK HVIMLFVPVT LCMVVVVATI KSVSFYTRKD GQLIYTPFTE 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mcc-055682|UBD,CUE|Macaca mulatta
Please wait for a moment...
Nucleotide Sequence
(Fasta)
GGGCGGGGCC TGGGACAGGC AGCTCCGGGG TCCGCGGTTT CACATCGGAA ACAAAACAGC 60
GGCTGGTCTG GAAGGAACCT GAACTGCGAG CGGCGGCAGC AACGGCGGCG GCGGCTAAGC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mcc-055682|UBD,CUE|Macaca mulatta
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-0256--Endoplasmic reticulum
KW-0333--Golgi apparatus
KW-0378--Hydrolase
KW-0472--Membrane
KW-0914--Notch signaling pathway
KW-0645--Protease
KW-1185--Reference proteome
KW-0812--Transmembrane
KW-1133--Transmembrane helix

Interpro

IPR002031--Pept_A22A_PS1
IPR001108--Peptidase_A22A
IPR006639--Preselin/SPP

Pfam

PF01080--Presenilin

PRINTS

PR01072--PRESENILIN
PR01073--PRESENILIN1

SMART

SM00730--PSN

Gene Ontology

GO:0016235--C:aggresome
GO:0030424--C:axon
GO:0005938--C:cell cortex
GO:0030054--C:cell junction
GO:0005813--C:centrosome
GO:0035253--C:ciliary rootlet
GO:0031410--C:cytoplasmic vesicle
GO:0043198--C:dendritic shaft
GO:0005783--C:endoplasmic reticulum
GO:0005789--C:endoplasmic reticulum membrane
GO:0070765--C:gamma-secretase complex
GO:0000139--C:Golgi membrane
GO:0030426--C:growth cone
GO:0005887--C:integral component of plasma membrane
GO:0000776--C:kinetochore
GO:0045121--C:membrane raft
GO:0005739--C:mitochondrion
GO:0043025--C:neuronal cell body
GO:0005640--C:nuclear outer membrane
GO:0005634--C:nucleus
GO:0048471--C:perinuclear region of cytoplasm
GO:0098793--C:presynapse
GO:0005791--C:rough endoplasmic reticulum
GO:0005790--C:smooth endoplasmic reticulum
GO:0030018--C:Z disc
GO:0042500--F:aspartic endopeptidase activity, intramembrane cleaving
GO:0008013--F:beta-catenin binding
GO:0045296--F:cadherin binding
GO:0005262--F:calcium channel activity
GO:0004175--F:endopeptidase activity
GO:0000186--P:activation of MAPKK activity
GO:0042987--P:amyloid precursor protein catabolic process
GO:0000045--P:autophagosome assembly
GO:0034205--P:beta-amyloid formation
GO:0050435--P:beta-amyloid metabolic process
GO:0001568--P:blood vessel development
GO:0048854--P:brain morphogenesis
GO:0021870--P:Cajal-Retzius cell differentiation
GO:0006816--P:calcium ion transport
GO:0060070--P:canonical Wnt signaling pathway
GO:0001708--P:cell fate specification
GO:0006974--P:cellular response to DNA damage stimulus
GO:0021795--P:cerebral cortex cell migration
GO:0015871--P:choline transport
GO:0021904--P:dorsal/ventral neural tube patterning
GO:0030326--P:embryonic limb morphogenesis
GO:0050673--P:epithelial cell proliferation
GO:0001947--P:heart looping
GO:0002244--P:hematopoietic progenitor cell differentiation
GO:0035556--P:intracellular signal transduction
GO:0015813--P:L-glutamate transport
GO:0006509--P:membrane protein ectodomain proteolysis
GO:0007613--P:memory
GO:0006839--P:mitochondrial transport
GO:0043011--P:myeloid dendritic cell differentiation
GO:0043066--P:negative regulation of apoptotic process
GO:2001234--P:negative regulation of apoptotic signaling pathway
GO:0050771--P:negative regulation of axonogenesis
GO:0007175--P:negative regulation of epidermal growth factor-activated receptor activity
GO:2000059--P:negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process
GO:0000122--P:negative regulation of transcription from RNA polymerase II promoter
GO:0051444--P:negative regulation of ubiquitin-protein transferase activity
GO:0051402--P:neuron apoptotic process
GO:0048666--P:neuron development
GO:0001764--P:neuron migration
GO:0007220--P:Notch receptor processing
GO:0007219--P:Notch signaling pathway
GO:0043065--P:positive regulation of apoptotic process
GO:0050820--P:positive regulation of coagulation
GO:0060999--P:positive regulation of dendritic spine development
GO:0043406--P:positive regulation of MAP kinase activity
GO:0032436--P:positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0001921--P:positive regulation of receptor recycling
GO:0045893--P:positive regulation of transcription, DNA-templated
GO:0009791--P:post-embryonic development
GO:0006486--P:protein glycosylation
GO:0016485--P:protein processing
GO:0015031--P:protein transport
GO:0060828--P:regulation of canonical Wnt signaling pathway
GO:0043393--P:regulation of protein binding
GO:0060075--P:regulation of resting membrane potential
GO:0048167--P:regulation of synaptic plasticity
GO:0051966--P:regulation of synaptic transmission, glutamatergic
GO:0006979--P:response to oxidative stress
GO:0016337--P:single organismal cell-cell adhesion
GO:0048705--P:skeletal system morphogenesis
GO:0043589--P:skin morphogenesis
GO:0051563--P:smooth endoplasmic reticulum calcium ion homeostasis
GO:0001756--P:somitogenesis
GO:0016080--P:synaptic vesicle targeting
GO:0002286--P:T cell activation involved in immune response
GO:0050852--P:T cell receptor signaling pathway
GO:0048538--P:thymus development

KEGG mcc:696274
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000686 Aegilops tauschii 33.66 1.00e-22 102.00
IUUC-Aml-001648 Ailuropoda melanoleuca 92.05 4.00e-163 566.00
IUUC-Atr-003039 Amborella trichopoda 31.84 4.00e-39 155.00
IUUC-Apl-003727 Anas platyrhynchos 82.45 1.00e-179 622.00
IUUC-Aca-004582 Anolis carolinensis 80.93 0.00e+00 634.00
IUUC-Aly-005455 Arabidopsis lyrata 32.56 1.00e-18 87.40
IUUC-Ath-006730 Arabidopsis thaliana 32.50 1.00e-32 134.00
IUUC-Ame-011500 Astyanax mexicanus 72.96 1.00e-149 522.00
IUUC-Bta-013026 Bos taurus 89.12 0.00e+00 704.00
IUUC-Bdi-014196 Brachypodium distachyon 33.24 4.00e-29 122.00
IUUC-Bol-015841 Brassica oleracea 36.74 3.00e-32 132.00
IUUC-Bra-017580 Brassica rapa 35.11 5.00e-31 128.00
IUUC-Cel-018553 Caenorhabditis elegans 52.37 2.00e-94 338.00
IUUC-Cja-019994 Callithrix jacchus 99.29 0.00e+00 714.00
IUUC-Cfa-020074 Canis familiaris 93.79 0.00e+00 741.00
IUUC-Cpo-022237 Cavia porcellus 95.44 0.00e+00 719.00
IUUC-Csa-023537 Chlorocebus sabaeus 99.79 0.00e+00 814.00
IUUC-Cho-024735 Choloepus hoffmanni 82.30 0.00e+00 672.00
IUUC-Cin-025780 Ciona intestinalis 62.91 1.00e-124 439.00
IUUC-Csv-025967 Ciona savignyi 63.21 2.00e-119 422.00
IUUC-Dre-028689 Danio rerio 79.15 4.00e-145 507.00
IUUC-Dno-029758 Dasypus novemcinctus 92.11 0.00e+00 729.00
IUUC-Dor-030609 Dipodomys ordii 74.30 2.00e-177 615.00
IUUC-Dme-031929 Drosophila melanogaster 56.04 2.00e-109 389.00
IUUC-Ete-032487 Echinops telfairi 84.76 2.00e-85 309.00
IUUC-Eeu-035134 Erinaceus europaeus 91.21 4.00e-143 500.00
IUUC-Fca-036243 Felis catus 94.66 0.00e+00 736.00
IUUC-Fal-036600 Ficedula albicollis 82.34 1.00e-180 625.00
IUUC-Gmo-038550 Gadus morhua 65.66 1.00e-113 403.00
IUUC-Gga-040993 Gallus gallus 83.47 0.00e+00 635.00
IUUC-Gac-042342 Gasterosteus aculeatus 67.46 7.00e-130 457.00
IUUC-Gma-043822 Glycine max 39.85 1.00e-23 104.00
IUUC-Ggo-044859 Gorilla gorilla 100.00 1.00e-179 622.00
IUUC-Hsa-046822 Homo sapiens 100.00 0.00e+00 816.00
IUUC-Hvu-047141 Hordeum vulgare 35.41 2.00e-22 99.80
IUUC-Itr-048420 Ictidomys tridecemlineatus 96.89 5.00e-161 560.00
IUUC-Lch-049946 Latimeria chalumnae 69.54 9.00e-143 499.00
IUUC-Lpe-051132 Leersia perrieri 33.33 2.00e-30 126.00
IUUC-Loc-052469 Lepisosteus oculatus 63.36 3.00e-137 482.00
IUUC-Laf-053979 Loxodonta africana 89.41 0.00e+00 632.00
IUUC-Meu-056004 Macropus eugenii 75.89 3.00e-154 538.00
IUUC-Mtr-058392 Medicago truncatula 35.07 3.00e-30 125.00
IUUC-Mga-059466 Meleagris gallopavo 83.19 0.00e+00 632.00
IUUC-Mmr-061538 Microcebus murinus 79.01 6.00e-170 590.00
IUUC-Mdo-062122 Monodelphis domestica 86.84 0.00e+00 684.00
IUUC-Mmu-063176 Mus musculus 92.72 0.00e+00 733.00
IUUC-Mpu-065927 Mustela putorius furo 91.86 0.00e+00 725.00
IUUC-Mlu-067079 Myotis lucifugus 92.74 0.00e+00 756.00
IUUC-Nle-070180 Nomascus leucogenys 100.00 0.00e+00 816.00
IUUC-Opr-070847 Ochotona princeps 88.50 0.00e+00 679.00
IUUC-Ont-071846 Oreochromis niloticus 76.24 2.00e-145 508.00
IUUC-Oan-072783 Ornithorhynchus anatinus 83.13 1.00e-134 472.00
IUUC-Ocu-074527 Oryctolagus cuniculus 94.87 0.00e+00 770.00
IUUC-Oba-075256 Oryza barthii 35.05 1.00e-28 120.00
IUUC-Ogl-077097 Oryza glaberrima 34.26 2.00e-29 123.00
IUUC-Ogu-078570 Oryza glumaepatula 34.26 2.00e-29 123.00
IUUC-Oin-079244 Oryza indica 34.01 9.00e-29 121.00
IUUC-Olo-080484 Oryza longistaminata 35.42 2.00e-24 106.00
IUUC-Ome-081814 Oryza meridionalis 32.79 3.00e-30 126.00
IUUC-Oni-082057 Oryza nivara 34.01 8.00e-29 121.00
IUUC-Opu-084176 Oryza punctata 33.00 6.00e-29 121.00
IUUC-Oru-084618 Oryza rufipogon 34.26 3.00e-29 122.00
IUUC-Olu-087811 Ostreococcus lucimarinus 36.97 2.00e-47 182.00
IUUC-Oar-090348 Ovis aries 91.03 0.00e+00 744.00
IUUC-Ptr-091060 Pan troglodytes 100.00 0.00e+00 816.00
IUUC-Pan-091855 Papio anubis 90.15 0.00e+00 704.00
IUUC-Psi-093505 Pelodiscus sinensis 82.13 0.00e+00 632.00
IUUC-Pfo-097396 Poecilia formosa 74.81 2.00e-150 525.00
IUUC-Pab-098591 Pongo abelii 98.93 0.00e+00 800.00
IUUC-Pop-099661 Populus trichocarpa 34.26 2.00e-32 133.00
IUUC-Pca-101029 Procavia capensis 87.63 0.00e+00 676.00
IUUC-Ppe-101495 Prunus persica 32.46 1.00e-37 150.00
IUUC-Pva-102244 Pteropus vampyrus 86.97 0.00e+00 683.00
IUUC-Pgr-103562 Puccinia graminis 33.33 4.40e-02 33.50
IUUC-Rno-105861 Rattus norvegicus 92.32 0.00e+00 712.00
IUUC-Sha-107045 Sarcophilus harrisii 87.66 0.00e+00 686.00
IUUC-Smo-109325 Selaginella moellendorffii 36.83 5.00e-38 151.00
IUUC-Sit-110624 Setaria italica 34.58 8.00e-27 114.00
IUUC-Stu-112433 Solanum tuberosum 35.32 5.00e-34 138.00
IUUC-Sar-113169 Sorex araneus 87.61 5.00e-142 497.00
IUUC-Sbi-114305 Sorghum bicolor 36.28 1.00e-27 117.00
IUUC-Ssc-115766 Sus scrofa 92.74 0.00e+00 720.00
IUUC-Tgu-116469 Taeniopygia guttata 87.32 1.00e-139 489.00
IUUC-Tru-117732 Takifugu rubripes 76.56 1.00e-145 509.00
IUUC-Tsy-119624 Tarsius syrichta 85.50 0.00e+00 675.00
IUUC-Tni-119852 Tetraodon nigroviridis 70.82 7.00e-136 477.00
IUUC-Tca-121865 Theobroma cacao 33.92 1.00e-37 150.00
IUUC-Tae-125925 Triticum aestivum 36.13 5.00e-28 119.00
IUUC-Tur-126237 Triticum urartu 34.43 2.00e-23 103.00
IUUC-Tbe-128148 Tupaia belangeri 88.56 2.00e-178 618.00
IUUC-Ttr-128793 Tursiops truncatus 91.67 0.00e+00 706.00
IUUC-Vpa-130625 Vicugna pacos 75.80 9.00e-161 559.00
IUUC-Vvi-131312 Vitis vinifera 34.43 3.00e-34 139.00
IUUC-Xtr-131790 Xenopus tropicalis 78.56 2.00e-160 558.00
IUUC-Xma-133377 Xiphophorus maculatus 74.76 7.00e-148 516.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved