• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • mRNA Expression
    • GEO
    • FFGED
  • PPI
    • IID
    • iRefIndex
    • HINT
    • Mentha
  • 3D Structure
    • PDB
    • MMDB
  • PTM
    • CPLM
    • dbPAF
    • dbPTM
    • UniProt
    • PHOSIDA
    • BioGRID
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Aor-010012
Ensembl Protein ID BAE55074
UniProt Accession Q5KU00; SKP1_ASPOR
Genbank Protein ID BAD83607.1; BAD83610.1; BAE55074.1
Protein Name E3 ubiquitin ligase complex SCF subunit sconC; Sulfur controller C; Sulfur metabolite repression control protein C
Genbank Nucleotide ID AB063104; AB070846; AP007150
Gene Name sconC; skpA; AO090009000653
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
AO090009000653 BAE55074 BAE55074
Status Unreviewed
Classification
Family E-Value Score Start End
E3 adaptor/Cullin RING/SCF/SKP1 3.10e-31 106.6 111 158
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   E3 adaptor/Cullin RING/SCF/SKP1

   S: 1    ksLLdltcktVadmikgktpeeiRktFnienDftpeEeakvReEnqWA 48
    k+LLd++cktVa+mikgk+peeiRktFni+nDftpeEe+++R+En+WA
   Q: 111 KGLLDVGCKTVANMIKGKSPEEIRKTFNIQNDFTPEEEDQIRRENEWA 158
    89*********************************************9 PP
   

Organism Aspergillus oryzae
Functional Description
(View)

Functional Description



     Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor (By similarity).
Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor (By similarity).
Protein Sequence
(Fasta)
MATPTLTFTS SDGVDIPVER DVAERSQLIK NMLEDLGETG EPIPIPNVNE AVLKKVIEWC 60
THHKNDPPST GDDDDSRRKT TDIDEWDQKF MQVDQEMLFE IILAANYLDI KGLLDVGCKT 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Aor-010012|E3,SKP1|Aspergillus oryzae
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGGCCACTC CTACTCTAAC CTTCACGAGC TCCGACGGCG TTGACATCCC TGTCGGTAGG 60
TGCATTCATC ATGATCGATA CCTTTTACCA AGAAGAGATC CATGATTTCT CTCTTCATCT 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Aor-010012|E3,SKP1|Aspergillus oryzae
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome
KW-0833--Ubl conjugation pathway

Interpro

IPR016897--SKP1
IPR001232--SKP1-like
IPR011333--SKP1/BTB/POZ
IPR016072--Skp1_comp_dimer
IPR016073--Skp1_comp_POZ

Pfam

PF01466--Skp1
PF03931--Skp1_POZ

SMART

SM00512--Skp1

Gene Ontology

GO:0016567--P:protein ubiquitination
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG aor:AOR_1_1098184
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-001036 Aegilops tauschii 55.19 2.00e-45 172.00
IUUC-Aml-002023 Ailuropoda melanoleuca 62.96 9.00e-48 180.00
IUUC-Atr-002858 Amborella trichopoda 55.56 8.00e-37 144.00
IUUC-Apl-003393 Anas platyrhynchos 62.96 9.00e-48 180.00
IUUC-Aca-004709 Anolis carolinensis 62.96 9.00e-48 180.00
IUUC-Aly-006236 Arabidopsis lyrata 49.07 2.00e-40 155.00
IUUC-Ath-007456 Arabidopsis thaliana 50.00 1.00e-41 160.00
IUUC-Ago-007847 Ashbya gossypii 54.02 4.00e-49 185.00
IUUC-Acl-008178 Aspergillus clavatus 91.77 4.00e-84 301.00
IUUC-Afl-008452 Aspergillus flavus 100.00 4.00e-93 331.00
IUUC-Afu-008785 Aspergillus fumigatus 92.95 3.00e-83 298.00
IUUC-Ani-009312 Aspergillus nidulans 84.47 9.00e-71 256.00
IUUC-Ate-010375 Aspergillus terreus 94.97 4.00e-87 311.00
IUUC-Ame-011025 Astyanax mexicanus 63.58 4.00e-48 181.00
IUUC-Bgr-012280 Blumeria graminis 72.03 2.00e-47 179.00
IUUC-Bta-013519 Bos taurus 62.96 9.00e-48 180.00
IUUC-Bci-013888 Botrytis cinerea 79.51 6.00e-45 171.00
IUUC-Bdi-014547 Brachypodium distachyon 51.95 2.00e-35 139.00
IUUC-Bol-016431 Brassica oleracea 52.20 7.00e-37 144.00
IUUC-Bra-017062 Brassica rapa 52.29 6.00e-25 104.00
IUUC-Cel-018653 Caenorhabditis elegans 70.25 9.00e-50 187.00
IUUC-Cja-019785 Callithrix jacchus 63.82 3.00e-43 165.00
IUUC-Cfa-020931 Canis familiaris 62.96 2.00e-47 179.00
IUUC-Cpo-022487 Cavia porcellus 62.35 1.00e-45 173.00
IUUC-Cre-022751 Chlamydomonas reinhardtii 55.00 2.00e-40 156.00
IUUC-Csa-023459 Chlorocebus sabaeus 62.35 2.00e-47 179.00
IUUC-Cho-024854 Choloepus hoffmanni 60.32 4.00e-15 71.60
IUUC-Cin-025538 Ciona intestinalis 59.63 5.00e-45 171.00
IUUC-Csv-025865 Ciona savignyi 59.01 4.00e-49 184.00
IUUC-Cgl-026548 Colletotrichum gloeosporioides 76.60 3.00e-60 222.00
IUUC-Cne-027058 Cryptococcus neoformans 70.19 8.00e-63 230.00
IUUC-Cme-027174 Cyanidioschyzon merolae 43.59 2.00e-34 135.00
IUUC-Dre-027756 Danio rerio 63.58 4.00e-48 181.00
IUUC-Dno-028924 Dasypus novemcinctus 62.96 9.00e-48 180.00
IUUC-Dor-030847 Dipodomys ordii 56.52 6.00e-42 160.00
IUUC-Dse-031209 Dothistroma septosporum 80.12 1.00e-68 249.00
IUUC-Dme-032028 Drosophila melanogaster 54.04 7.00e-48 181.00
IUUC-Ete-033117 Echinops telfairi 60.49 6.00e-45 171.00
IUUC-Eca-033320 Equus caballus 62.96 9.00e-48 180.00
IUUC-Eeu-034817 Erinaceus europaeus 70.45 2.00e-14 67.80
IUUC-Fca-035423 Felis catus 62.96 9.00e-48 180.00
IUUC-Fal-036956 Ficedula albicollis 62.96 9.00e-48 180.00
IUUC-Fox-037761 Fusarium oxysporum 75.17 1.00e-60 223.00
IUUC-Fso-038451 Fusarium solani 74.83 8.00e-59 217.00
IUUC-Gmo-039178 Gadus morhua 63.58 4.00e-48 181.00
IUUC-Ggr-039831 Gaeumannomyces graminis 73.61 4.00e-58 214.00
IUUC-Gga-040238 Gallus gallus 62.96 9.00e-48 180.00
IUUC-Gac-041965 Gasterosteus aculeatus 63.58 4.00e-48 181.00
IUUC-Gma-042996 Glycine max 54.49 7.00e-36 140.00
IUUC-Ggo-045025 Gorilla gorilla 62.96 9.00e-48 180.00
IUUC-Hsa-046875 Homo sapiens 62.96 9.00e-48 180.00
IUUC-Hvu-047497 Hordeum vulgare 53.50 2.00e-39 152.00
IUUC-Itr-047900 Ictidomys tridecemlineatus 61.11 2.00e-46 176.00
IUUC-Kpa-049138 Komagataella pastoris 54.64 2.00e-47 179.00
IUUC-Lch-050522 Latimeria chalumnae 64.33 3.00e-51 192.00
IUUC-Lpe-050890 Leersia perrieri 53.75 1.00e-34 137.00
IUUC-Loc-052596 Lepisosteus oculatus 63.58 4.00e-48 181.00
IUUC-Lma-053020 Leptosphaeria maculans 76.06 3.00e-55 205.00
IUUC-Laf-053847 Loxodonta africana 62.96 9.00e-48 180.00
IUUC-Mor-057176 Magnaporthe oryzae 74.31 2.00e-58 216.00
IUUC-Mpo-057471 Magnaporthe poae 73.61 3.00e-58 215.00
IUUC-Mtr-058458 Medicago truncatula 48.72 1.00e-39 153.00
IUUC-Mla-059153 Melampsora laricipopulina 68.15 8.00e-57 210.00
IUUC-Mga-059864 Meleagris gallopavo 62.96 9.00e-48 180.00
IUUC-Mvi-060342 Microbotryum violaceum 72.22 2.00e-65 239.00
IUUC-Mdo-062509 Monodelphis domestica 62.96 9.00e-48 180.00
IUUC-Mmu-063694 Mus musculus 63.58 4.00e-48 181.00
IUUC-Mac-064537 Musa acuminata 53.66 6.00e-36 141.00
IUUC-Mpu-065990 Mustela putorius furo 62.96 9.00e-48 180.00
IUUC-Mlu-068168 Myotis lucifugus 62.96 9.00e-48 180.00
IUUC-Nfi-068309 Neosartorya fischeri 92.95 3.00e-83 298.00
IUUC-Ncr-068658 Neurospora crassa 72.30 8.00e-59 217.00
IUUC-Nle-070101 Nomascus leucogenys 62.96 9.00e-48 180.00
IUUC-Opr-070881 Ochotona princeps 62.96 9.00e-48 180.00
IUUC-Ont-071529 Oreochromis niloticus 63.58 4.00e-48 181.00
IUUC-Oan-073000 Ornithorhynchus anatinus 81.03 1.00e-25 105.00
IUUC-Ocu-073780 Oryctolagus cuniculus 62.96 9.00e-48 180.00
IUUC-Oba-075368 Oryza barthii 47.93 3.00e-35 139.00
IUUC-Obr-076218 Oryza brachyantha 56.33 1.00e-38 150.00
IUUC-Ogl-077257 Oryza glaberrima 46.75 3.00e-37 145.00
IUUC-Ogu-078125 Oryza glumaepatula 49.09 8.00e-35 137.00
IUUC-Oin-080141 Oryza indica 46.75 3.00e-37 145.00
IUUC-Olo-080834 Oryza longistaminata 42.38 4.00e-34 135.00
IUUC-Ome-081330 Oryza meridionalis 49.39 5.00e-35 138.00
IUUC-Oni-082067 Oryza nivara 47.52 8.00e-35 137.00
IUUC-Opu-083354 Oryza punctata 50.87 2.00e-35 139.00
IUUC-Oru-084769 Oryza rufipogon 44.44 6.00e-35 137.00
IUUC-Osa-085416 Oryza sativa 48.48 7.00e-35 137.00
IUUC-Ola-087270 Oryzias latipes 63.58 4.00e-48 181.00
IUUC-Olu-087667 Ostreococcus lucimarinus 52.56 6.00e-43 164.00
IUUC-Oga-089073 Otolemur garnettii 62.96 9.00e-48 180.00
IUUC-Oar-089391 Ovis aries 58.75 5.00e-41 157.00
IUUC-Ptr-090872 Pan troglodytes 59.01 4.00e-46 175.00
IUUC-Pan-091780 Papio anubis 62.96 9.00e-48 180.00
IUUC-Psi-093135 Pelodiscus sinensis 62.96 9.00e-48 180.00
IUUC-Pno-094810 Phaeosphaeria nodorum 76.06 2.00e-51 192.00
IUUC-Ppa-095274 Physcomitrella patens 55.35 5.00e-40 154.00
IUUC-Pfo-097529 Poecilia formosa 63.58 4.00e-48 181.00
IUUC-Pab-098533 Pongo abelii 62.96 9.00e-48 180.00
IUUC-Pop-099815 Populus trichocarpa 50.63 5.00e-37 144.00
IUUC-Pca-100783 Procavia capensis 53.70 6.00e-37 144.00
IUUC-Ppe-101410 Prunus persica 51.63 2.00e-41 159.00
IUUC-Pva-102901 Pteropus vampyrus 62.96 9.00e-48 180.00
IUUC-Pgr-103499 Puccinia graminis 68.79 2.00e-58 215.00
IUUC-Ptt-103874 Puccinia triticina 75.19 1.00e-54 204.00
IUUC-Pte-104224 Pyrenophora teres 80.28 1.00e-50 190.00
IUUC-Pyt-104750 Pyrenophora triticirepentis 78.32 9.00e-51 190.00
IUUC-Rno-105499 Rattus norvegicus 63.03 1.00e-48 183.00
IUUC-Sce-106387 Saccharomyces cerevisiae 48.72 1.00e-45 173.00
IUUC-Sja-107902 Schizosaccharomyces japonicus 69.81 1.00e-61 226.00
IUUC-Spo-108033 Schizosaccharomyces pombe 70.25 4.00e-61 224.00
IUUC-Ssl-108591 Sclerotinia sclerotiorum 77.40 4.00e-62 228.00
IUUC-Smo-109307 Selaginella moellendorffii 56.38 2.00e-39 152.00
IUUC-Sit-110435 Setaria italica 50.93 2.00e-35 139.00
IUUC-Sly-111627 Solanum lycopersicum 52.20 5.00e-36 141.00
IUUC-Stu-112023 Solanum tuberosum 52.60 2.00e-36 142.00
IUUC-Sar-112973 Sorex araneus 56.79 6.00e-39 150.00
IUUC-Sbi-114394 Sorghum bicolor 53.46 2.00e-39 152.00
IUUC-Sre-115178 Sporisorium reilianum 73.25 6.00e-67 244.00
IUUC-Tgu-116474 Taeniopygia guttata 62.96 9.00e-48 180.00
IUUC-Tru-118429 Takifugu rubripes 62.96 4.00e-48 181.00
IUUC-Tsy-118896 Tarsius syrichta 62.96 9.00e-48 180.00
IUUC-Tni-119960 Tetraodon nigroviridis 62.96 4.00e-48 181.00
IUUC-Tca-121022 Theobroma cacao 54.55 1.00e-38 150.00
IUUC-Tre-122004 Trichoderma reesei 65.33 5.00e-50 187.00
IUUC-Tvi-122449 Trichoderma virens 70.27 4.00e-50 188.00
IUUC-Tae-125854 Triticum aestivum 55.19 2.00e-45 172.00
IUUC-Tur-126421 Triticum urartu 55.92 2.00e-41 159.00
IUUC-Tme-127078 Tuber melanosporum 78.98 9.00e-62 226.00
IUUC-Tbe-127720 Tupaia belangeri 62.96 9.00e-48 180.00
IUUC-Ttr-129035 Tursiops truncatus 62.96 9.00e-48 180.00
IUUC-Uma-129517 Ustilago maydis 72.61 2.00e-65 239.00
IUUC-Vda-129691 Verticillium dahliae 72.48 7.00e-54 200.00
IUUC-Vpa-130128 Vicugna pacos 62.96 1.00e-47 180.00
IUUC-Vvi-130876 Vitis vinifera 53.50 6.00e-44 167.00
IUUC-Xtr-132393 Xenopus tropicalis 62.96 9.00e-48 180.00
IUUC-Xma-133603 Xiphophorus maculatus 63.58 4.00e-48 181.00
IUUC-Yli-134499 Yarrowia lipolytica 69.57 1.00e-62 229.00
IUUC-Zma-134722 Zea mays 46.20 5.00e-35 139.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved