• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
    • ArrayExpress
    • GXD
  • DNA & RNA Element
    • AREsite
    • miRTarBase
    • microRNA
    • TRANSFAC
    • RAID2
  • PPI
    • IID
  • PTM
    • dbPAF
  • Proteomics
    • GPMDB

Tag Content
iUUCD ID IUUC-Pan-092074
Ensembl Protein ID ENSPANP00000002739.1
UniProt Accession A0A096MSH0; A0A096MSH0_PAPAN
Genbank Protein ID ENSPANP00000002739
Protein Name Uncharacterized protein
Genbank Nucleotide ID AHZZ01193325
Gene Name N4BP2
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSPANG00000005533.1 ENSPANT00000007960.1 ENSPANP00000002739.1
Status Unreviewed
Classification
Family E-Value Score Start End
UBD/Alpha-Helix/CUE 2.30e-09 37.2 46 88
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/Alpha-Helix/CUE

   S: 1    dletaleqLkeiFPnldysviqvvLeantgsleaavnnLLegs 43
    d+e++++ + e+F +ld++v++ +L+++++ +e+a+++LLe+s
   Q: 46 DQEELFTSISEMFSDLDPDVVYLMLSECDFKVENAMDCLLELS 88
    689**************************************97 PP
   

Organism Papio anubis
Protein Sequence
(Fasta)
MPRKRKNLGG NPFRKTANPK EVIVSSVASR EEPTTTLPSM GETKVDQEEL FTSISEMFSD 60
LDPDVVYLML SECDFKVENA MDCLLELSAT DTKIEESSSQ SFVASGNQVG AAESEIMEKH 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Pan-092074|UBD,CUE|Papio anubis
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATGCCAAGGA AAAGGAAAAA TCTTGGGGGA AATCCTTTTC GGAAGACTGC AAACCCTAAG 60
GAAGTTATCG TATCCAGTGT TGCTAGTCGT GAGGAGCCAA CCACTACTCT TCCTTCCATG 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Pan-092074|UBD,CUE|Papio anubis
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0181--Complete proteome
KW-1185--Reference proteome

Interpro

IPR003892--CUE
IPR013899--DUF1771
IPR027417--P-loop_NTPase
IPR002625--Smr_dom
IPR009060--UBA-like

PROSITE

PS51140--CUE
PS50828--SMR

Pfam

PF02845--CUE
PF08590--DUF1771
PF01713--Smr

SMART

SM01162--DUF1771
SM00463--SMR

Gene Ontology

GO:0005829--C:cytosol
GO:0005524--F:ATP binding
GO:0046404--F:ATP-dependent polydeoxyribonucleotide 5'-hydroxyl-kinase activity
GO:0004519--F:endonuclease activity

Orthology
iUUCD ID Species Identity E-value Score
IUUC-Ata-000307 Aegilops tauschii 30.77 8.00e-16 78.60
IUUC-Aml-001291 Ailuropoda melanoleuca 79.18 0.00e+00 2640.00
IUUC-Atr-002800 Amborella trichopoda 33.33 1.00e-16 80.90
IUUC-Apl-003628 Anas platyrhynchos 46.23 0.00e+00 733.00
IUUC-Aca-005334 Anolis carolinensis 43.02 0.00e+00 912.00
IUUC-Aly-006196 Arabidopsis lyrata 30.91 2.00e-13 70.90
IUUC-Ath-006720 Arabidopsis thaliana 30.91 1.00e-13 71.60
IUUC-Ago-007797 Ashbya gossypii 33.58 1.00e-10 59.70
IUUC-Acl-008358 Aspergillus clavatus 30.52 7.00e-14 72.40
IUUC-Afl-008652 Aspergillus flavus 32.47 2.00e-13 71.60
IUUC-Afu-008968 Aspergillus fumigatus 30.52 8.00e-14 72.40
IUUC-Ang-009527 Aspergillus niger 31.17 6.00e-14 72.80
IUUC-Aor-010090 Aspergillus oryzae 32.47 1.00e-13 71.60
IUUC-Ate-010565 Aspergillus terreus 31.17 9.00e-14 72.00
IUUC-Ame-011671 Astyanax mexicanus 51.72 1.00e-104 375.00
IUUC-Bgr-012080 Blumeria graminis 31.47 2.00e-12 65.90
IUUC-Bta-013181 Bos taurus 77.88 0.00e+00 2514.00
IUUC-Bci-013717 Botrytis cinerea 34.62 7.00e-13 67.40
IUUC-Bdi-014201 Brachypodium distachyon 29.49 1.00e-15 78.20
IUUC-Bol-015623 Brassica oleracea 33.13 4.00e-15 76.30
IUUC-Bra-017329 Brassica rapa 31.48 1.00e-14 74.30
IUUC-Cja-019184 Callithrix jacchus 88.56 0.00e+00 2953.00
IUUC-Cfa-021092 Canis familiaris 78.89 0.00e+00 2544.00
IUUC-Cpo-022517 Cavia porcellus 67.74 0.00e+00 1904.00
IUUC-Csa-024113 Chlorocebus sabaeus 97.18 0.00e+00 3297.00
IUUC-Cho-025097 Choloepus hoffmanni 72.40 0.00e+00 2378.00
IUUC-Cgl-026652 Colletotrichum gloeosporioides 31.54 2.00e-11 64.30
IUUC-Cme-027204 Cyanidioschyzon merolae 31.16 1.00e-12 65.90
IUUC-Dre-028125 Danio rerio 48.88 5.00e-92 333.00
IUUC-Dno-028869 Dasypus novemcinctus 74.73 0.00e+00 2439.00
IUUC-Dor-030516 Dipodomys ordii 68.22 0.00e+00 1833.00
IUUC-Dse-031379 Dothistroma septosporum 33.85 2.00e-10 58.90
IUUC-Ete-032277 Echinops telfairi 55.79 0.00e+00 764.00
IUUC-Eca-034418 Equus caballus 79.79 0.00e+00 2531.00
IUUC-Fca-035464 Felis catus 78.34 0.00e+00 2485.00
IUUC-Fal-036958 Ficedula albicollis 44.58 0.00e+00 707.00
IUUC-Fox-037804 Fusarium oxysporum 26.80 4.00e-02 32.30
IUUC-Fso-038365 Fusarium solani 26.73 4.00e-03 36.20
IUUC-Ggr-039919 Gaeumannomyces graminis 31.01 2.00e-04 40.80
IUUC-Gga-040829 Gallus gallus 44.89 0.00e+00 714.00
IUUC-Gma-043695 Glycine max 32.92 8.00e-17 82.00
IUUC-Ggo-045014 Gorilla gorilla 93.08 0.00e+00 2520.00
IUUC-Hsa-046049 Homo sapiens 94.19 0.00e+00 3183.00
IUUC-Hvu-047315 Hordeum vulgare 30.13 8.00e-16 78.60
IUUC-Itr-047979 Ictidomys tridecemlineatus 79.82 0.00e+00 2008.00
IUUC-Kpa-049234 Komagataella pastoris 32.82 2.00e-09 55.80
IUUC-Lch-050089 Latimeria chalumnae 57.08 2.00e-136 481.00
IUUC-Lpe-050913 Leersia perrieri 30.00 2.00e-15 77.00
IUUC-Loc-052313 Lepisosteus oculatus 53.53 2.00e-113 404.00
IUUC-Laf-054208 Loxodonta africana 69.58 0.00e+00 1926.00
IUUC-Mcc-055097 Macaca mulatta 97.80 0.00e+00 3288.00
IUUC-Meu-056220 Macropus eugenii 48.54 2.00e-131 464.00
IUUC-Mor-057049 Magnaporthe oryzae 25.00 1.00e-05 44.70
IUUC-Mtr-057639 Medicago truncatula 33.33 1.00e-15 78.60
IUUC-Mla-058827 Melampsora laricipopulina 35.00 5.00e-12 62.80
IUUC-Mga-060071 Meleagris gallopavo 46.13 0.00e+00 749.00
IUUC-Mmu-063261 Mus musculus 68.67 0.00e+00 2075.00
IUUC-Mac-065582 Musa acuminata 31.25 3.00e-18 86.70
IUUC-Mpu-066564 Mustela putorius furo 78.48 0.00e+00 2019.00
IUUC-Mlu-067134 Myotis lucifugus 79.96 0.00e+00 2564.00
IUUC-Nfi-068329 Neosartorya fischeri 37.69 4.00e-15 75.10
IUUC-Ncr-068888 Neurospora crassa 36.15 3.00e-13 68.90
IUUC-Nle-070076 Nomascus leucogenys 93.51 0.00e+00 3093.00
IUUC-Opr-071217 Ochotona princeps 66.52 0.00e+00 2071.00
IUUC-Ont-072331 Oreochromis niloticus 50.62 2.00e-102 367.00
IUUC-Oan-073398 Ornithorhynchus anatinus 50.15 0.00e+00 794.00
IUUC-Ocu-074175 Oryctolagus cuniculus 74.50 0.00e+00 1775.00
IUUC-Oba-074981 Oryza barthii 29.68 4.00e-16 79.30
IUUC-Obr-076223 Oryza brachyantha 30.77 8.00e-17 81.60
IUUC-Ogl-077577 Oryza glaberrima 29.68 4.00e-16 79.30
IUUC-Ogu-078879 Oryza glumaepatula 29.38 1.00e-15 78.20
IUUC-Oin-079288 Oryza indica 29.68 4.00e-16 79.30
IUUC-Olo-080622 Oryza longistaminata 29.68 4.00e-16 79.70
IUUC-Ome-081674 Oryza meridionalis 29.38 1.00e-15 78.20
IUUC-Oni-082814 Oryza nivara 30.32 2.00e-16 80.50
IUUC-Opu-083966 Oryza punctata 29.87 2.00e-14 75.50
IUUC-Oru-084603 Oryza rufipogon 29.68 4.00e-16 79.30
IUUC-Osa-086109 Oryza sativa 29.68 4.00e-16 79.30
IUUC-Oga-089167 Otolemur garnettii 78.08 0.00e+00 2489.00
IUUC-Oar-090067 Ovis aries 77.43 0.00e+00 2532.00
IUUC-Ptr-091648 Pan troglodytes 94.19 0.00e+00 3184.00
IUUC-Psi-094006 Pelodiscus sinensis 41.70 0.00e+00 1081.00
IUUC-Pma-094605 Petromyzon marinus 43.23 1.00e-86 315.00
IUUC-Pno-094845 Phaeosphaeria nodorum 36.92 5.00e-14 72.80
IUUC-Ppa-095472 Physcomitrella patens 30.62 1.00e-16 81.60
IUUC-Pfo-096653 Poecilia formosa 48.16 5.00e-102 366.00
IUUC-Pab-097841 Pongo abelii 93.80 0.00e+00 3176.00
IUUC-Pop-099018 Populus trichocarpa 33.33 2.00e-15 77.00
IUUC-Pca-100710 Procavia capensis 67.69 0.00e+00 893.00
IUUC-Ppe-101241 Prunus persica 28.85 7.00e-12 65.50
IUUC-Pva-102564 Pteropus vampyrus 74.52 0.00e+00 2382.00
IUUC-Ptt-103766 Puccinia triticina 53.33 2.50e+00 26.60
IUUC-Pte-104103 Pyrenophora teres 34.88 1.70e-01 30.80
IUUC-Rno-105882 Rattus norvegicus 68.41 0.00e+00 2068.00
IUUC-Sce-106211 Saccharomyces cerevisiae 29.76 8.00e-03 35.00
IUUC-Sha-107043 Sarcophilus harrisii 48.81 0.00e+00 1263.00
IUUC-Sja-107849 Schizosaccharomyces japonicus 31.43 8.00e-12 63.50
IUUC-Spo-108072 Schizosaccharomyces pombe 30.99 3.00e-08 53.50
IUUC-Ssl-108444 Sclerotinia sclerotiorum 32.31 1.00e-09 56.60
IUUC-Smo-108891 Selaginella moellendorffii 35.00 4.00e-20 92.80
IUUC-Sit-109705 Setaria italica 31.17 7.00e-12 65.50
IUUC-Sly-111484 Solanum lycopersicum 31.01 4.00e-16 79.70
IUUC-Stu-112625 Solanum tuberosum 31.01 2.00e-16 80.50
IUUC-Sar-113440 Sorex araneus 68.96 0.00e+00 2146.00
IUUC-Sbi-114730 Sorghum bicolor 29.03 2.00e-15 77.40
IUUC-Sre-115226 Sporisorium reilianum 30.83 6.00e-10 58.20
IUUC-Ssc-115744 Sus scrofa 78.54 0.00e+00 2069.00
IUUC-Tgu-116540 Taeniopygia guttata 63.57 1.00e-148 521.00
IUUC-Tru-118415 Takifugu rubripes 46.59 1.00e-100 361.00
IUUC-Tsy-119380 Tarsius syrichta 66.57 0.00e+00 866.00
IUUC-Tni-120411 Tetraodon nigroviridis 48.17 1.00e-102 368.00
IUUC-Tca-121821 Theobroma cacao 32.52 1.00e-13 71.60
IUUC-Tre-122107 Trichoderma reesei 36.15 7.00e-15 73.90
IUUC-Tvi-122309 Trichoderma virens 36.15 6.00e-14 70.90
IUUC-Tae-123527 Triticum aestivum 30.77 6.00e-16 79.00
IUUC-Tur-125957 Triticum urartu 31.41 6.00e-17 82.00
IUUC-Tme-126978 Tuber melanosporum 36.09 2.00e-16 79.00
IUUC-Tbe-127331 Tupaia belangeri 58.78 0.00e+00 993.00
IUUC-Ttr-128559 Tursiops truncatus 79.34 0.00e+00 2565.00
IUUC-Uma-129434 Ustilago maydis 30.08 3.00e-09 55.50
IUUC-Vda-129975 Verticillium dahliae 33.33 1.00e-13 70.50
IUUC-Vpa-130807 Vicugna pacos 76.19 0.00e+00 2028.00
IUUC-Vvi-131687 Vitis vinifera 30.49 3.00e-13 70.10
IUUC-Xma-133915 Xiphophorus maculatus 37.37 5.00e-120 426.00
IUUC-Yli-134541 Yarrowia lipolytica 33.55 7.00e-15 73.90
IUUC-Zma-134705 Zea mays 28.85 5.00e-09 56.20
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved