• HOME
  • BROWSE
  • SEARCH
  • LINK
  • DOWNLOAD
  • USER GUIDE
  • Protein
  • Gene
  • Annotation
  • Details
  • Classification
  • Domain Profile
  • Function
  • Protein Sequence
  • Nucleotide Sequence
  • Keyword
  • GO
  • Orthology
  • TOP
  • SNP
    • dbSNP
  • mRNA Expression
    • GEO
  • DNA & RNA Element
    • RAID2
  • PPI
    • IID
  • Proteomics
    • GPMDB

Basic Information Integrated Annotations

Tag Content
UUCD2 ID IUUC-Mmu-063685
Ensembl Protein ID ENSMUSP00000001950.5
UniProt Accession Q9QZ06; Q543N1; Q9D5P5; TOLIP_MOUSE
Genbank Protein ID CAB58121.1; BAB30262.1; BAC32357.1; BAC33643.1; BAE36316.1; AAH62139.1
Protein Name Toll-interacting protein
Genbank Nucleotide ID AJ242971; AK015062; AK045422; AK049263; AK161312; BC062139
Gene Name Tollip
Ensembl Information
Ensembl Gene ID Ensembl Transcript ID Ensembl Protein ID
ENSMUSG00000025139.14 ENSMUST00000055819.12 ENSMUSP00000051485.6
ENSMUSG00000025139.14 ENSMUST00000001950.11 ENSMUSP00000001950.5
ENSMUSG00000025139.14 ENSMUST00000130439.2 ENSMUSP00000117938.2
Annotation
Single Nucleotide Polymorphisms (SNP)
dbSNP
mRNA Expression
GEOArrayExpressGXD
DNA & RNA Element
miRTarBasemicroRNATRANSFACRepTar
RAID2
Protein-protein Interaction
IIDiRefIndexMentha
Post-translational Modifications (PTMs)
CPLMPhosphositePlusdbPTM
Protein Expression/Proteomics
GPMDB
Status Reviewed
Details
Family Domain References (PMIDs)
UBD/Other/Other UBD/Other/Other 19444506; 24600555
Classification
Family E-value Score Start End
UBD/Alpha-Helix/CUE 3.00e-15 56.8 229 271
Active Site
Position(s) Description Evidence
N/A N/A N/A
Domain Profile

   UBD/Alpha-Helix/CUE

   S: 1    dletaleqLkeiFPnldysviqvvLeantgsleaavnnLLegs 43
    ++e++l++++++FPn+d +vi++vLea++g+ +aa+n+LL++
   Q: 229 CNEEDLKAIQDMFPNMDREVIRSVLEAQRGNKDAAINSLLQMG 271
    68***************************************96 PP
   

Organism Mus musculus
Functional Description
(View)

Functional Description



     Component of the signaling pathway of IL-1 and Toll-like receptors. Inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex. Inhibits IRAK1 phosphorylation and kinase activity. Connects the ubiquitin pathway to autophagy by functioning as a ubiquitin-ATG8 family adapter and thus mediating autophagic clearance of ubiquitin conjugates. The TOLLIP-dependent selective autophagy pathway plays an important role in clearance of cytotoxic polyQ proteins aggregates (By similarity).
Component of the signaling pathway of IL-1 and Toll-like receptors. Inhibits cell activation by microbial products. Recruits IRAK1 to the IL-1 receptor complex. Inhibits IRAK1 phosphorylation and kinase activity. Connects the ubiquitin pathway to autophagy by functioning as a ubiquitin-ATG8 family adapter and thus mediating autophagic clearance of ubiquitin conjugates. The TOLLIP-dependent selective autophagy pathway plays an important role in clearance of cytotoxic polyQ proteins aggregates (By similarity).
Protein Sequence
(Fasta)
MATTVSTQRG PVYIGELPQD FLRITPTQQQ QQIQLDAQAA QQLQYGGTVG TVGRLSITVV 60
QAKLAKNYGM TRMDPYCRLR LGYAVYETPT AHNGAKNPRW NKVIQCTVPP GVDSFYLEIF 120
It may take some time, please wait.

Protein Fasta Sequence



>IUUC-Mmu-063685|UBD,UBD/Other/Other;UBD,CUE|Mus musculus
Please wait for a moment...
Nucleotide Sequence
(Fasta)
ATACCGTAAA AAGATGAACT GACATGAGGA CCCCTTTTTG TGGCTAAGAG GACATCATCA 60
TATCTGTACC AGGGTAAGAT GTTTTAGTAG TGTGGCTGCT TTTGGGGTCA CCCACACTCC 120
It may take some time, please wait.

Nucleotide Fasta Sequence



>IUUC-Mmu-063685|UBD,UBD/Other/Other;UBD,CUE|Mus musculus
Please wait for a moment...
Sequence Source Ensembl
Keyword

KW-0007--Acetylation
KW-0072--Autophagy
KW-0181--Complete proteome
KW-0963--Cytoplasm
KW-0391--Immunity
KW-0395--Inflammatory response
KW-0399--Innate immunity
KW-0597--Phosphoprotein
KW-1185--Reference proteome
KW-0677--Repeat

Interpro

IPR000008--C2_dom
IPR003892--CUE
IPR009060--UBA-like

PROSITE

PS51140--CUE

Pfam

PF00168--C2
PF02845--CUE

SMART

SM00239--C2
SM00546--CUE

Gene Ontology

GO:0005737--C:cytoplasm
GO:0070062--C:extracellular exosome
GO:0016604--C:nuclear body
GO:0048471--C:perinuclear region of cytoplasm
GO:0019900--F:kinase binding
GO:0035325--F:Toll-like receptor binding
GO:0043130--F:ubiquitin binding
GO:0031624--F:ubiquitin conjugating enzyme binding
GO:0006914--P:autophagy
GO:0030855--P:epithelial cell differentiation
GO:0006954--P:inflammatory response
GO:0045087--P:innate immune response
GO:0016310--P:phosphorylation
GO:0033235--P:positive regulation of protein sumoylation
GO:0036010--P:protein localization to endosome
GO:0007165--P:signal transduction
GO:0006511--P:ubiquitin-dependent protein catabolic process

KEGG mmu:54473
Orthology
iUUCD ID Species Identity E-value Score
IUUC-Aml-001566 Ailuropoda melanoleuca 91.25 7.00e-112 396.00
IUUC-Apl-003706 Anas platyrhynchos 90.88 3.00e-120 424.00
IUUC-Aca-004943 Anolis carolinensis 81.75 2.00e-107 381.00
IUUC-Ago-007813 Ashbya gossypii 25.98 2.00e-04 40.00
IUUC-Ame-011082 Astyanax mexicanus 82.91 2.00e-123 434.00
IUUC-Bgr-011976 Blumeria graminis 33.33 3.00e-04 40.00
IUUC-Bta-013259 Bos taurus 91.97 8.00e-118 416.00
IUUC-Bci-013731 Botrytis cinerea 36.11 7.50e-01 28.50
IUUC-Bdi-014407 Brachypodium distachyon 35.71 5.10e-02 31.60
IUUC-Cel-018399 Caenorhabditis elegans 35.58 8.00e-44 170.00
IUUC-Cja-018753 Callithrix jacchus 91.51 4.00e-128 451.00
IUUC-Cfa-020087 Canis familiaris 92.71 6.00e-112 396.00
IUUC-Cpo-021735 Cavia porcellus 87.27 3.00e-117 414.00
IUUC-Csa-023623 Chlorocebus sabaeus 93.04 2.00e-125 441.00
IUUC-Cin-025139 Ciona intestinalis 41.01 7.00e-38 150.00
IUUC-Csv-025877 Ciona savignyi 39.73 5.00e-49 187.00
IUUC-Cme-027282 Cyanidioschyzon merolae 34.15 2.70e-01 29.30
IUUC-Dre-028691 Danio rerio 81.82 2.00e-112 398.00
IUUC-Dno-029753 Dasypus novemcinctus 89.38 4.00e-110 390.00
IUUC-Dor-030201 Dipodomys ordii 84.58 1.00e-94 339.00
IUUC-Dse-031373 Dothistroma septosporum 29.37 5.00e-07 50.10
IUUC-Ete-032378 Echinops telfairi 86.85 6.00e-95 340.00
IUUC-Eca-034156 Equus caballus 93.92 3.00e-121 427.00
IUUC-Fca-035386 Felis catus 90.53 1.00e-113 402.00
IUUC-Fal-036799 Ficedula albicollis 91.46 7.00e-124 436.00
IUUC-Gmo-038999 Gadus morhua 77.78 6.00e-114 403.00
IUUC-Gga-041068 Gallus gallus 93.43 1.00e-132 465.00
IUUC-Ggo-044809 Gorilla gorilla 77.01 4.00e-92 331.00
IUUC-Hsa-046654 Homo sapiens 93.04 2.00e-125 441.00
IUUC-Itr-048912 Ictidomys tridecemlineatus 97.34 8.00e-123 432.00
IUUC-Lch-049986 Latimeria chalumnae 83.58 2.00e-125 441.00
IUUC-Loc-052419 Lepisosteus oculatus 54.04 2.00e-58 218.00
IUUC-Lma-053222 Leptosphaeria maculans 41.67 1.30e-01 31.20
IUUC-Laf-053390 Loxodonta africana 95.44 6.00e-118 416.00
IUUC-Mcc-054649 Macaca mulatta 93.13 2.00e-119 422.00
IUUC-Meu-056690 Macropus eugenii 95.74 9.00e-73 266.00
IUUC-Mor-057041 Magnaporthe oryzae 47.06 1.10e-02 34.70
IUUC-Mga-059674 Meleagris gallopavo 90.88 2.00e-120 424.00
IUUC-Mvi-060273 Microbotryum violaceum 36.84 6.70e-02 30.80
IUUC-Mmr-060744 Microcebus murinus 92.05 1.00e-118 418.00
IUUC-Mdo-062591 Monodelphis domestica 89.05 2.00e-128 451.00
IUUC-Mac-064554 Musa acuminata 26.40 1.00e-07 50.10
IUUC-Mpu-066005 Mustela putorius furo 90.49 8.00e-114 402.00
IUUC-Ncr-068740 Neurospora crassa 42.31 2.00e-04 40.80
IUUC-Nle-069520 Nomascus leucogenys 93.04 2.00e-125 441.00
IUUC-Opr-071036 Ochotona princeps 96.88 7.00e-86 309.00
IUUC-Ont-071379 Oreochromis niloticus 81.52 1.00e-118 419.00
IUUC-Oan-073508 Ornithorhynchus anatinus 94.23 1.00e-58 218.00
IUUC-Ocu-074753 Oryctolagus cuniculus 93.80 1.00e-115 409.00
IUUC-Ola-086417 Oryzias latipes 81.95 2.00e-122 431.00
IUUC-Olu-087609 Ostreococcus lucimarinus 40.00 5.00e-04 38.10
IUUC-Oga-088770 Otolemur garnettii 89.26 2.00e-115 408.00
IUUC-Oar-089528 Ovis aries 49.45 1.00e-32 133.00
IUUC-Pan-091998 Papio anubis 93.04 2.00e-125 441.00
IUUC-Psi-093365 Pelodiscus sinensis 93.13 3.00e-120 424.00
IUUC-Pma-094505 Petromyzon marinus 53.48 4.00e-72 264.00
IUUC-Pfo-096152 Poecilia formosa 82.31 7.00e-124 436.00
IUUC-Pab-097752 Pongo abelii 93.04 2.00e-125 441.00
IUUC-Pop-099461 Populus trichocarpa 45.24 1.40e-01 30.40
IUUC-Pca-100823 Procavia capensis 79.85 3.00e-117 414.00
IUUC-Pva-102815 Pteropus vampyrus 87.35 1.00e-107 382.00
IUUC-Pyt-104628 Pyrenophora triticirepentis 41.18 5.30e-01 28.90
IUUC-Rno-105011 Rattus norvegicus 99.64 1.00e-130 458.00
IUUC-Sha-107028 Sarcophilus harrisii 87.10 3.00e-71 259.00
IUUC-Ssl-108621 Sclerotinia sclerotiorum 36.84 4.50e-01 29.30
IUUC-Smo-109303 Selaginella moellendorffii 25.00 1.00e-08 51.60
IUUC-Stu-112916 Solanum tuberosum 30.33 7.00e-11 59.30
IUUC-Sar-113252 Sorex araneus 66.01 3.00e-43 167.00
IUUC-Sre-115062 Sporisorium reilianum 48.48 2.00e-04 40.40
IUUC-Ssc-116217 Sus scrofa 57.92 2.00e-56 212.00
IUUC-Tgu-116503 Taeniopygia guttata 94.16 2.00e-126 445.00
IUUC-Tru-118257 Takifugu rubripes 82.25 4.00e-122 430.00
IUUC-Tni-120576 Tetraodon nigroviridis 76.98 3.00e-112 397.00
IUUC-Tca-121166 Theobroma cacao 28.10 4.00e-07 48.10
IUUC-Tvi-122320 Trichoderma virens 40.62 4.20e-01 29.30
IUUC-Tbe-128094 Tupaia belangeri 92.50 1.00e-101 362.00
IUUC-Ttr-128957 Tursiops truncatus 98.36 1.00e-52 200.00
IUUC-Uma-129647 Ustilago maydis 41.67 6.00e-06 45.80
IUUC-Vda-129734 Verticillium dahliae 44.68 1.00e-03 38.10
IUUC-Xtr-132846 Xenopus tropicalis 82.35 3.00e-112 397.00
Created Date 25-Jun-2017

https://dev.news.makassarkota.go.id/public/pgsoft-demo/ https://jdih.sumbawabaratkab.go.id/lato/pg-soft-demo/ https://dev.news.makassarkota.go.id/public/slot-gacor/ http://pbb.tanahbumbukab.go.id/-/slot-gacor/ slot gacor https://siakad.unipra.ac.id/sass/slot-gacor-x500/ http://kpm.dinus.ac.id/assets/images/berita/slot/
Copyright © 2004-2017.The CUCKOO Workgroup. All Rights Reserved